DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arr and nid2a

DIOPT Version :9

Sequence 1:NP_524737.2 Gene:arr / 44279 FlyBaseID:FBgn0000119 Length:1678 Species:Drosophila melanogaster
Sequence 2:XP_005169904.1 Gene:nid2a / 322921 ZFINID:ZDB-GENE-030827-2 Length:1804 Species:Danio rerio


Alignment Length:276 Identity:97/276 - (35%)
Similarity:146/276 - (52%) Gaps:21/276 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 PTGVKLISANTCANGSQEMMFIVQRTQISKISLDSPDYTIFPLPL-GKVKYAIAIDYDPVEEHIY 449
            |||..|:    .|.|.|..:..:..||:.|      :.:...|.| |.:  .:.||||..|..:|
Zfish  1539 PTGTSLL----YAQGQQIGVLPLNGTQMDK------ERSSVLLALHGSI--VVGIDYDCRERKVY 1591

  Fly   450 WSDVETYTIKRAHAD-GTGVTDFVTSEVRHPDGLALDWLARNLYWTDTVTDRIEVCRLDGTARKV 513
            |:|:...||.||..| |:.....:.:.:..|:|||:|...|.|:|.|:..|:||...|||:.|.|
Zfish  1592 WTDLAGRTINRASLDPGSEPEIIINTALTSPEGLAVDVARRRLFWVDSTLDKIETANLDGSDRHV 1656

  Fly   514 LIYEHLEEPRAIAVAPSLGWMFWSDWNERKPKVERASLDGSERVVLVSENLGWPNGIALDIEAKA 578
            |....|..|||:.|..|.|.::|:|||...||:|.:|:||..|.|||.|.:|.||.:..|...:.
Zfish  1657 LFATDLVNPRAMIVDSSTGTLYWTDWNREAPKIESSSVDGQNRRVLVQEGIGLPNALTYDSTMRQ 1721

  Fly   579 IYWCDGKTDKIEVANMDGSGRRVVISDNLKHLFGLSILDDYLYWTDWQRR---SIDRAHKITGNN 640
            :.|.|..|.::|..:.:|:||| ||..||.:.|.:....::.|:|||:|.   |:.|.:::|.. 
Zfish  1722 VCWADAGTKRLECISPNGTGRR-VIQSNLNYPFSMVYFANHYYYTDWRRDGVISLGRDNQLTDE- 1784

  Fly   641 RIVVVDQYPDLMGLKV 656
              .:.||...|.|:.|
Zfish  1785 --YLPDQRSHLYGITV 1798

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
arrNP_524737.2 LY 162..201 CDD:214531
NHL 168..503 CDD:302697 38/118 (32%)
NHL repeat 172..237 CDD:271320
LY 252..293 CDD:214531
NHL repeat 261..298 CDD:271320
NHL repeat 303..339 CDD:271320
NHL repeat 341..419 CDD:271320 10/32 (31%)
NHL repeat 428..476 CDD:271320 17/49 (35%)
LY 472..511 CDD:214531 15/38 (39%)
NHL repeat 477..503 CDD:271320 11/25 (44%)
Ldl_recept_b 534..573 CDD:278487 18/38 (47%)
LY 558..599 CDD:214531 13/40 (33%)
LY 600..641 CDD:214531 14/43 (33%)
FXa_inhibition 668..703 CDD:291342
LY 739..773 CDD:214531
LY 776..818 CDD:214531
LY 819..860 CDD:214531
FXa_inhibition 973..1010 CDD:291342
LY 1122..1164 CDD:214531
FXa_inhibition 1273..1313 CDD:291342
LDLa 1319..1362 CDD:238060
LDLa 1365..1399 CDD:238060
LDLa 1399..1433 CDD:197566
nid2aXP_005169904.1 NIDO 113..278 CDD:214712
EGF_3 442..470 CDD:289699
nidG2 474..697 CDD:238158
EGF_3 710..746 CDD:289699
EGF_CA 748..790 CDD:214542
EGF_3 799..828 CDD:289699
Thyroglobulin_1 839..905 CDD:278514
Thyroglobulin_1 915..978 CDD:278514
Thyroglobulin_1 991..1054 CDD:278514
Thyroglobulin_1 1067..1130 CDD:278514
Thyroglobulin_1 1143..1206 CDD:278514
Thyroglobulin_1 1219..1282 CDD:278514
Thyroglobulin_1 1295..1358 CDD:278514
Thyroglobulin_1 1371..1434 CDD:278514
TY 1453..1518 CDD:238114
LY 1569..1606 CDD:214531 15/38 (39%)
LY 1612..1654 CDD:214531 15/41 (37%)
LY 1655..1699 CDD:214531 19/43 (44%)
LY 1700..1742 CDD:214531 13/41 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590469
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.