DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arr and Lrp10

DIOPT Version :9

Sequence 1:NP_524737.2 Gene:arr / 44279 FlyBaseID:FBgn0000119 Length:1678 Species:Drosophila melanogaster
Sequence 2:NP_001382489.1 Gene:Lrp10 / 305880 RGDID:1310471 Length:712 Species:Rattus norvegicus


Alignment Length:479 Identity:117/479 - (24%)
Similarity:172/479 - (35%) Gaps:131/479 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1265 PKVLRNHTCMH-SRTKCSHICIASGEGIARTRDVCSCPKHLMLLEDKENCGAFPA-------CGP 1321
            |::||:.|  | |..|...:...||:.:.....|.           ..|...|.|       |.|
  Rat   259 PRLLRSLT--HFSNGKAVTVETLSGQAVVSYHTVA-----------WSNGRGFNATYHVRGYCLP 310

  Fly  1322 DHFTCAAPVSGI---SDVNKDCIPASWRCDGQKDCPDKSDEVGCPTCRADQFSCQSG------EC 1377
            ....|... ||:   .::.:.|...:.||||..||.|.:||.|||.|....:.|.:.      .|
  Rat   311 WDRPCGLG-SGLGASENLGERCYSEAQRCDGSWDCADGTDEEGCPGCPPGHYPCGAAGTPGATAC 374

  Fly  1378 IDKSLVCDGTTNCANGHDEADC--CKRPGEFQCPINKLCISAALLCDGWENCADGADE-SSDICL 1439
            ...:..|:..|.||:|.||..|  | :||.|:|...| |:....:|||..:|.||:|| .....|
  Rat   375 YLPADRCNYQTFCADGADERRCRHC-QPGNFRCRDEK-CVYETWVCDGQPDCTDGSDEWDCSYAL 437

  Fly  1440 QRRMAPATDKRAFMILIGATMITIFSIVYLLQFCRTRIGKSRTEPKDDQATDPLS---------- 1494
            .|::..|.       :||:.:..:..::.|  .|..::...||:.....|  |||          
  Rat   438 PRKVITAA-------VIGSLVCGLLLVIAL--GCTCKLYAIRTQEYSIFA--PLSRMEAEIVQQQ 491

  Fly  1495 -PSTLSKSQRVSKIASVADAVR-----MSTLNSRNSMNSYDRNHITGASSS----TTNGSS---- 1545
             |.:..:......|..|.|...     .|.|.:..|:....|..:|...:|    ...|.|    
  Rat   492 APPSYGQLIAQGAIPPVEDFPTENPNDNSVLGNLRSLLQILRQDMTPGGTSGGRRRQRGRSVRRL 556

  Fly  1546 --------MVAYPINPPPSPATRSRRPYRHYKIINQPPPPTPCSTDICDESDSNYTSKSNSNNSN 1602
                    ::.....|..:|.|||           |..|..|  ::..|:|    |.::....:.
  Rat   557 VRRLRRWGLLPRTNTPARAPETRS-----------QATPSVP--SEALDDS----TGQACEGGAV 604

  Fly  1603 GGATKHSSSSAAACLQYGYDSEPYP---PPPTPRSHYHSDVRIVPESSCPPSP-------SSRSS 1657
            ||             |.|..:.|.|   |.|||     |.:..:..:|.||.|       ||..|
  Rat   605 GG-------------QDGEQAPPLPIKSPIPTP-----STLPALATASEPPGPLPSVPVESSLLS 651

  Fly  1658 TYFSP-----LPP--PPSPVQSPS 1674
            .....     ||.  ||.|..:|:
  Rat   652 GVVQVLRGRLLPSLWPPGPTWTPT 675

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
arrNP_524737.2 LY 162..201 CDD:214531
NHL 168..503 CDD:302697
NHL repeat 172..237 CDD:271320
LY 252..293 CDD:214531
NHL repeat 261..298 CDD:271320
NHL repeat 303..339 CDD:271320
NHL repeat 341..419 CDD:271320
NHL repeat 428..476 CDD:271320
LY 472..511 CDD:214531
NHL repeat 477..503 CDD:271320
Ldl_recept_b 534..573 CDD:278487
LY 558..599 CDD:214531
LY 600..641 CDD:214531
FXa_inhibition 668..703 CDD:291342
LY 739..773 CDD:214531
LY 776..818 CDD:214531
LY 819..860 CDD:214531
FXa_inhibition 973..1010 CDD:291342
LY 1122..1164 CDD:214531
FXa_inhibition 1273..1313 CDD:291342 6/40 (15%)
LDLa 1319..1362 CDD:238060 15/45 (33%)
LDLa 1365..1399 CDD:238060 10/39 (26%)
LDLa 1399..1433 CDD:197566 14/35 (40%)
Lrp10NP_001382489.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349222
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.