DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arr and LpR1

DIOPT Version :9

Sequence 1:NP_524737.2 Gene:arr / 44279 FlyBaseID:FBgn0000119 Length:1678 Species:Drosophila melanogaster
Sequence 2:NP_001097934.2 Gene:LpR1 / 2768687 FlyBaseID:FBgn0066101 Length:1076 Species:Drosophila melanogaster


Alignment Length:407 Identity:139/407 - (34%)
Similarity:196/407 - (48%) Gaps:61/407 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   359 NPCAHNNGNCSHLCL-------------------------------------LATNS-QGFSCAC 385
            |.||..||.|.|.|:                                     :..|. .||.|.|
  Fly   512 NECASKNGGCMHQCIDLKVGHHCECHEGYKLSPDKRNCQDINECEVPGKCSQICVNEIGGFKCEC 576

  Fly   386 PTGVKLISAN--TC-ANGSQEMMFIVQRTQISKISLDSPDYTIFPLPLGKVKYAIAIDYDPVEEH 447
            ..|......|  .| |:.....:.:.:|..|.||:||..:.|..   :...|.|.|:|:......
  Fly   577 EAGYMRDPKNHTRCKASEGHASLLLARRHDIRKIALDHMEMTSI---VNSTKAATALDFVFRTGM 638

  Fly   448 IYWSDVETYTIKRAHAD-GTGVTDFVTSEVRHPDGLALDWLARNLYWTDTVTDRIEVCRLDGTAR 511
            |:||||.|.:|.:|..| |...|..:|......||||:||:..::|:|||....||:...:|:..
  Fly   639 IFWSDVTTQSIYKAPIDEGNEKTVVLTKSSVTSDGLAVDWIYNHVYFTDTHKCTIELTNFEGSMG 703

  Fly   512 KVLIYEHLEEPRAIAVAPSLGWMFWSDWNERKPKVERASLDGSERVVLVSENLGWPNGIALDIEA 576
            |||:.:.|:.||:||:.|..|||:||||. ..|::|||.:|||.|..::|.::.|||||.||:..
  Fly   704 KVLVKDSLDIPRSIALDPIEGWMYWSDWG-ASPRIERAGMDGSHRTTIISYDVKWPNGITLDLVK 767

  Fly   577 KAIYWCDGKTDKIEVANMDGSGRRVVI--SDNLKHLFGLSILDDYLYWTDWQRRSIDRAHKITGN 639
            |.|||.|||.:.|..||.|||.|..|:  .:.|:|.|.::..:|.:|||||.::::.:|:|.||.
  Fly   768 KRIYWVDGKLNVISSANYDGSQRSQVLYSGEYLRHPFSITTFEDNVYWTDWDKQAVFKANKFTGE 832

  Fly   640 NRIVVVD----QYPDLMGLKVTR-LREVRGQNACAVRNGGCSHLCLNRPR------DYVCRCAID 693
            :...|..    |:|  |.:.|.. .|:..|.|.|...||.||||||..||      ...|.|...
  Fly   833 DVEPVTAMHMLQHP--MVVHVYHPYRQPDGVNHCQSVNGHCSHLCLPAPRINERSPRISCACPTG 895

  Fly   694 YELANDKRTCVVPAAFL 710
            .:|..|...||....:|
  Fly   896 LKLMVDGLMCVEDPLYL 912

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
arrNP_524737.2 LY 162..201 CDD:214531
NHL 168..503 CDD:302697 51/185 (28%)
NHL repeat 172..237 CDD:271320
LY 252..293 CDD:214531
NHL repeat 261..298 CDD:271320
NHL repeat 303..339 CDD:271320
NHL repeat 341..419 CDD:271320 21/100 (21%)
NHL repeat 428..476 CDD:271320 16/48 (33%)
LY 472..511 CDD:214531 14/38 (37%)
NHL repeat 477..503 CDD:271320 11/25 (44%)
Ldl_recept_b 534..573 CDD:278487 19/38 (50%)
LY 558..599 CDD:214531 21/40 (53%)
LY 600..641 CDD:214531 14/42 (33%)
FXa_inhibition 668..703 CDD:291342 15/40 (38%)
LY 739..773 CDD:214531
LY 776..818 CDD:214531
LY 819..860 CDD:214531
FXa_inhibition 973..1010 CDD:291342
LY 1122..1164 CDD:214531
FXa_inhibition 1273..1313 CDD:291342
LDLa 1319..1362 CDD:238060
LDLa 1365..1399 CDD:238060
LDLa 1399..1433 CDD:197566
LpR1NP_001097934.2 LDLa 135..167 CDD:197566
LDLa 178..210 CDD:197566
LDLa 219..254 CDD:238060
LDLa 259..295 CDD:238060
LDLa 343..373 CDD:238060
LDLa 383..415 CDD:197566
Ldl_recept_a 423..459 CDD:278486
LDLa 476..504 CDD:197566
FXa_inhibition 514..549 CDD:291342 7/34 (21%)
EGF_CA 551..581 CDD:214542 6/29 (21%)
LY 662..702 CDD:214531 14/39 (36%)
LY 704..747 CDD:214531 23/43 (53%)
LY 749..790 CDD:214531 21/40 (53%)
FXa_inhibition 864..905 CDD:291342 15/40 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461695
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.