Sequence 1: | NP_524737.2 | Gene: | arr / 44279 | FlyBaseID: | FBgn0000119 | Length: | 1678 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_032721.2 | Gene: | Nid2 / 18074 | MGIID: | 1298229 | Length: | 1403 | Species: | Mus musculus |
Alignment Length: | 203 | Identity: | 85/203 - (41%) |
---|---|---|---|
Similarity: | 123/203 - (60%) | Gaps: | 2/203 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 437 IAIDYDPVEEHIYWSDVETYTIKRAHAD-GTGVTDFVTSEVRHPDGLALDWLARNLYWTDTVTDR 500
Fly 501 IEVCRLDGTARKVLIYEHLEEPRAIAVAPSLGWMFWSDWNERKPKVERASLDGSERVVLVSENLG 565
Fly 566 WPNGIALDIEAKAIYWCDGKTDKIEVANMDGSGRRVVISDNLKHLFGLSILDDYLYWTDWQRRSI 630
Fly 631 DRAHKITG 638 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
arr | NP_524737.2 | LY | 162..201 | CDD:214531 | |
NHL | 168..503 | CDD:302697 | 28/66 (42%) | ||
NHL repeat | 172..237 | CDD:271320 | |||
LY | 252..293 | CDD:214531 | |||
NHL repeat | 261..298 | CDD:271320 | |||
NHL repeat | 303..339 | CDD:271320 | |||
NHL repeat | 341..419 | CDD:271320 | |||
NHL repeat | 428..476 | CDD:271320 | 16/39 (41%) | ||
LY | 472..511 | CDD:214531 | 18/38 (47%) | ||
NHL repeat | 477..503 | CDD:271320 | 12/25 (48%) | ||
Ldl_recept_b | 534..573 | CDD:278487 | 17/38 (45%) | ||
LY | 558..599 | CDD:214531 | 14/40 (35%) | ||
LY | 600..641 | CDD:214531 | 13/39 (33%) | ||
FXa_inhibition | 668..703 | CDD:291342 | |||
LY | 739..773 | CDD:214531 | |||
LY | 776..818 | CDD:214531 | |||
LY | 819..860 | CDD:214531 | |||
FXa_inhibition | 973..1010 | CDD:291342 | |||
LY | 1122..1164 | CDD:214531 | |||
FXa_inhibition | 1273..1313 | CDD:291342 | |||
LDLa | 1319..1362 | CDD:238060 | |||
LDLa | 1365..1399 | CDD:238060 | |||
LDLa | 1399..1433 | CDD:197566 | |||
Nid2 | NP_032721.2 | NIDO | 108..275 | CDD:214712 | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 323..403 | ||||
EGF_3 | 511..546 | CDD:289699 | |||
nidG2 | 548..780 | CDD:294123 | |||
EGF_3 | 786..822 | CDD:289699 | |||
EGF_CA | 824..865 | CDD:284955 | |||
EGF_3 | 875..913 | CDD:289699 | |||
EGF_3 | 919..952 | CDD:289699 | |||
Cell attachment site | 946..948 | ||||
TY | 967..1028 | CDD:238114 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1021..1043 | ||||
TY | 1047..1112 | CDD:238114 | |||
LY | 1162..1200 | CDD:214531 | 13/26 (50%) | ||
LDL-receptor class B 1 | 1182..1225 | 16/42 (38%) | |||
LY | 1206..1248 | CDD:214531 | 18/41 (44%) | ||
LDL-receptor class B 2 | 1226..1268 | 22/41 (54%) | |||
LY | 1249..1293 | CDD:214531 | 22/43 (51%) | ||
LDL-receptor class B 3 | 1269..1313 | 19/43 (44%) | |||
LY | 1294..1336 | CDD:214531 | 14/41 (34%) | ||
LDL-receptor class B 4 | 1314..1355 | 15/41 (37%) | |||
LDL-receptor class B 5 | 1357..1401 | 7/18 (39%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167845801 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |