DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arr and F14B4.1

DIOPT Version :9

Sequence 1:NP_524737.2 Gene:arr / 44279 FlyBaseID:FBgn0000119 Length:1678 Species:Drosophila melanogaster
Sequence 2:NP_492474.2 Gene:F14B4.1 / 172750 WormBaseID:WBGene00008779 Length:722 Species:Caenorhabditis elegans


Alignment Length:420 Identity:139/420 - (33%)
Similarity:196/420 - (46%) Gaps:60/420 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 QRGSLNALDLQTRELKELIDTPKAPNSVRAWDPSLQPYED------------------------- 358
            :|.|.:..:|.|..:|   ..|||           ||.|:                         
 Worm   224 KRNSESRCELNTNAIK---SRPKA-----------QPLEECDTQGNCKCRLPGYYYEAARKKCLD 274

  Fly   359 -NPCAHNNGNCSHLCLLATNSQG-FSCAC-PTGVKLISAN-TCANGSQEMM--FIVQRTQISKIS 417
             :.|...:..||..|:   |..| |.|.| |...||.:.| ||....|..|  |......:..||
 Worm   275 VDECESLSSACSQKCV---NLPGTFECTCDPRTYKLATDNKTCERIDQSPMWLFFAHGQSVWNIS 336

  Fly   418 LDSPDYTIFPLPLGKVKYAIAIDYDPVEEHIYWSDVETYTIKRAHADGTGVTDFVTSEVRHPDGL 482
            .|...   |.|....::....||.|..|..:|::|:....|:|.:.:||........:|...:|:
 Worm   337 TDGKS---FQLQRAGLQKTAMIDIDVKENRLYYADIGANVIERMNIEGTFPQAVQRFDVDGLEGI 398

  Fly   483 ALDWLARNLYWTDTVTDRIEVCRLDGTARKVLIYEHLEEPRAIAVAPSLGWMFWSDWNERKPKVE 547
            |:||:.||||  ....:.|.|..|||..|:.|....:..||:|.:.|:.|.||.:||: ....:.
 Worm   399 AVDWIGRNLY--SLRREDILVQSLDGRFRQPLYKNVMTLPRSITLHPAKGIMFVTDWS-ANAFIA 460

  Fly   548 RASLDGSERVVLVSENLGWPNGIALDIEAKAIYWCDGKTDKIEVANMDGSGRRVVISD--NLKHL 610
            .||:|||....:::|.:.|||.:|:||.|:.|||.|...|.||.|||||:||||:|:|  ::.|:
 Worm   461 AASMDGSHFRKIITERITWPNAVAVDIFAEKIYWADAFLDTIESANMDGTGRRVIIADAGSVPHV 525

  Fly   611 FGLSILDDYLYWTDWQRRSIDRAHKITGNNRIVVVDQYPDL-MGLKVTRLREVRGQNACAVRNGG 674
            |||:|.|||||||||..|.|.||:|..|.| |.|:.|...| ..|||.. :.::.:........|
 Worm   526 FGLAIADDYLYWTDWTYRGILRANKHNGEN-ITVLAQTALLPYSLKVFH-KSLQPEETSTCETRG 588

  Fly   675 CSHLC-LNRPRDYVCRCAIDYELANDKRTC 703
            |..|| |.......|.|...::|.||.:.|
 Worm   589 CDQLCLLGENGAATCACGEGFDLLNDGKKC 618

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
arrNP_524737.2 LY 162..201 CDD:214531
NHL 168..503 CDD:302697 54/214 (25%)
NHL repeat 172..237 CDD:271320
LY 252..293 CDD:214531
NHL repeat 261..298 CDD:271320
NHL repeat 303..339 CDD:271320 5/19 (26%)
NHL repeat 341..419 CDD:271320 25/108 (23%)
NHL repeat 428..476 CDD:271320 11/47 (23%)
LY 472..511 CDD:214531 14/38 (37%)
NHL repeat 477..503 CDD:271320 9/25 (36%)
Ldl_recept_b 534..573 CDD:278487 14/38 (37%)
LY 558..599 CDD:214531 20/40 (50%)
LY 600..641 CDD:214531 24/42 (57%)
FXa_inhibition 668..703 CDD:291342 10/35 (29%)
LY 739..773 CDD:214531
LY 776..818 CDD:214531
LY 819..860 CDD:214531
FXa_inhibition 973..1010 CDD:291342
LY 1122..1164 CDD:214531
FXa_inhibition 1273..1313 CDD:291342
LDLa 1319..1362 CDD:238060
LDLa 1365..1399 CDD:238060
LDLa 1399..1433 CDD:197566
F14B4.1NP_492474.2 vWFA <272..313 CDD:294047 13/43 (30%)
LY 343..383 CDD:214531 10/39 (26%)
LY 391..425 CDD:214531 14/35 (40%)
Ldl_recept_b 448..486 CDD:278487 14/38 (37%)
LY 470..512 CDD:214531 20/41 (49%)
LY 513..549 CDD:214531 21/35 (60%)
FXa_inhibition 588..618 CDD:291342 10/29 (34%)
LDLa 622..658 CDD:238060
LDLa 663..698 CDD:238060
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.