DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arr and ldlr

DIOPT Version :9

Sequence 1:NP_524737.2 Gene:arr / 44279 FlyBaseID:FBgn0000119 Length:1678 Species:Drosophila melanogaster
Sequence 2:XP_002942891.1 Gene:ldlr / 100495826 XenbaseID:XB-GENE-962372 Length:894 Species:Xenopus tropicalis


Alignment Length:436 Identity:137/436 - (31%)
Similarity:216/436 - (49%) Gaps:77/436 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 ELIDTPKAPN---SVRAW-DPSLQPYEDNPCAHNNGNCSHLCLLATNSQ--GFSCACPTGVKLI- 392
            |.|...|..|   ..|.| |..::...:|.|..|||.|:|:|    |..  |:.|.|..|.:|: 
 Frog   288 ECITMDKVCNKKRDCRDWSDEPIKECGENECMRNNGGCAHIC----NDLKIGYECLCNEGYRLVD 348

  Fly   393 -----------SANTCAN-----------------------------GSQEMMFIVQRTQISKIS 417
                       :.|||:.                             |:...:|...|.::.|::
 Frog   349 KKRCEDINECENPNTCSQICINLDGGYKCECREGYQMDPVTASCKSIGTVAYLFFTNRHEVRKMT 413

  Fly   418 LDSPDYTIFPLPLGKVKYAIAIDYDPVEEHIYWSDV---ETYTIKRAHADGTGVTD-FVTSEVRH 478
            ||..:||.|   :.::|..:|:|.:.....|||||:   :.|:.....||.|...: .::|:::.
 Frog   414 LDRSEYTSF---IPRLKNVVALDMEIASNKIYWSDLTQRKIYSASMDKADNTSHHETVISSQIQA 475

  Fly   479 PDGLALDWLARNLYWTDTVTDRIEVCRLDGTARKVLIYEHLEEPRAIAVAPSLGWMFWSDWNERK 543
            |||:|:||:..|:||||:....|.|...:|:.||.|..:.|.:||.|.|.||.|:|:|:||. ..
 Frog   476 PDGIAVDWIHGNIYWTDSKFSTISVANTEGSKRKTLFSDDLAKPRDIVVDPSQGFMYWTDWG-LP 539

  Fly   544 PKVERASLDGSERVVLVSENLGWPNGIALDIEAKAIYWCDGKTDKIEVANMDGSGRRVVISD--N 606
            .|:|:..|:|.:|..||:||:.|||||.||:..:.:||.|.|...:...::.|..|..||||  :
 Frog   540 AKIEKGGLNGVDRYPLVTENIEWPNGITLDLTNQRLYWVDSKLHSLSCIDVTGQNRITVISDETH 604

  Fly   607 LKHLFGLSILDDYLYWTDWQRRSIDRAHKITGNNRIVVVDQYPDLMG----LKVTRLREVRGQNA 667
            |.|.|||::.:|.::|||.:..:|..|:::||:|...|.:   ||:.    :....||:.:.:|.
 Frog   605 LAHPFGLTVFEDLVFWTDIENEAIFSANRLTGSNITKVAE---DLLSPEDIVLYHNLRQPKAENW 666

  Fly   668 CA---VRNGGCSHLCL------NRPRDYVCRCAIDYELANDKRTCV 704
            |.   :.||||.:|||      :|...:.|.|.....|..|.|:||
 Frog   667 CESHHLGNGGCEYLCLPAPLITSRSPKFTCACPDGMHLGADMRSCV 712

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
arrNP_524737.2 LY 162..201 CDD:214531
NHL 168..503 CDD:302697 58/218 (27%)
NHL repeat 172..237 CDD:271320
LY 252..293 CDD:214531
NHL repeat 261..298 CDD:271320
NHL repeat 303..339 CDD:271320 2/3 (67%)
NHL repeat 341..419 CDD:271320 26/124 (21%)
NHL repeat 428..476 CDD:271320 13/51 (25%)
LY 472..511 CDD:214531 15/38 (39%)
NHL repeat 477..503 CDD:271320 12/25 (48%)
Ldl_recept_b 534..573 CDD:278487 18/38 (47%)
LY 558..599 CDD:214531 16/40 (40%)
LY 600..641 CDD:214531 17/42 (40%)
FXa_inhibition 668..703 CDD:291342 14/43 (33%)
LY 739..773 CDD:214531
LY 776..818 CDD:214531
LY 819..860 CDD:214531
FXa_inhibition 973..1010 CDD:291342
LY 1122..1164 CDD:214531
FXa_inhibition 1273..1313 CDD:291342
LDLa 1319..1362 CDD:238060
LDLa 1365..1399 CDD:238060
LDLa 1399..1433 CDD:197566
ldlrXP_002942891.1 Ldl_recept_a 27..60 CDD:365841
Ldl_recept_a 68..106 CDD:365841
LDLa 111..145 CDD:238060
Ldl_recept_a 149..185 CDD:365841
Ldl_recept_a 195..231 CDD:365841
Ldl_recept_a 235..270 CDD:365841
LDLa 278..308 CDD:381805 6/19 (32%)
FXa_inhibition 318..352 CDD:373209 13/37 (35%)
EGF_CA 354..384 CDD:214542 3/29 (10%)
LY 419..457 CDD:214531 12/40 (30%)
Ldl_recept_b 439..482 CDD:278487 14/42 (33%)
Ldl_recept_b 486..525 CDD:278487 15/38 (39%)
Ldl_recept_b 529..569 CDD:278487 19/40 (48%)
LY 555..595 CDD:214531 16/39 (41%)
Ldl_recept_b 616..655 CDD:278487 12/41 (29%)
FXa_inhibition 674..711 CDD:373209 13/36 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.