DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and SOX13

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_005677.2 Gene:SOX13 / 9580 HGNCID:11192 Length:622 Species:Homo sapiens


Alignment Length:309 Identity:85/309 - (27%)
Similarity:123/309 - (39%) Gaps:100/309 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PPHHTSAALHGHAASPYSALA-PLMNLGQSHLTHS-QLSHHNHHHHHMSAHIAASQSPNPLSSLQ 80
            ||.|....:     :|.|.|| |:..:....:.:. ||.|               ..|.|:....
Human   233 PPSHQPLPV-----TPDSQLALPIQPIPCKPVEYPLQLLH---------------SPPAPVVKRP 277

  Fly    81 SSMANTLNGSQVGQQQQQQQQQQSSPLH-----SSSELSPTQSSIGSHHMTS----PVSHQQHTQ 136
            .:||.           ....|:.|.||:     .:.|| |..||..|..|:|    |.||...|:
Human   278 GAMAT-----------HHPLQEPSQPLNLTAKPKAPEL-PNTSSSPSLKMSSCVPRPPSHGGPTR 330

  Fly   137 QQQHGQQQ----HLGAGSAL--------------SSLTGGSSNN-------NNNSATA------- 169
            ..|.....    .||.|.|:              |....||.|.       :.:|:.|       
Human   331 DLQSSPPSLPLGFLGEGDAVTKAIQDARQLLHSHSGALDGSPNTPFRKDLISLDSSPAKERLEDG 395

  Fly   170 ----------------------NKNQQHADRVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKR 212
                                  ::|..|   :||||||||||::.:|||:....|.||||.|||.
Human   396 CVHPLEEAMLSCDMDGSRHFPESRNSSH---IKRPMNAFMVWAKDERRKILQAFPDMHNSSISKI 457

  Fly   213 LGAQWKDLSESEKRPFIDEAKRLRAVHMKEHPDYKYRPRRKTKTLTKTK 261
            ||::||.::..||:|:.:|..||...|::::|||||:||.|...:.:.|
Human   458 LGSRWKSMTNQEKQPYYEEQARLSRQHLEKYPDYKYKPRPKRTCIVEGK 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 36/70 (51%)
SOX13NP_005677.2 SOX-TCF_HMG-box 423..494 CDD:238684 37/73 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.