DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and NHP6B

DIOPT Version :10

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_009647.2 Gene:NHP6B / 852386 SGDID:S000002157 Length:99 Species:Saccharomyces cerevisiae


Alignment Length:66 Identity:20/66 - (30%)
Similarity:38/66 - (57%) Gaps:2/66 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 TANKNQQHADRVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEA 232
            |..|...:|.  ||.::|:|.::...|..:.|:||.:...::.:.||.:||.|:..||:|:..:|
Yeast    18 TRRKKDPNAP--KRGLSAYMFFANENRDIVRSENPDVTFGQVGRILGERWKALTAEEKQPYESKA 80

  Fly   233 K 233
            :
Yeast    81 Q 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 HMG-box_SoxB 177..252 CDD:438790 17/57 (30%)
NHP6BNP_009647.2 HMG-box_NHP6-like 14..94 CDD:438792 20/66 (30%)

Return to query results.
Submit another query.