DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and HMGB3

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_001031075.1 Gene:HMGB3 / 838659 AraportID:AT1G20696 Length:147 Species:Arabidopsis thaliana


Alignment Length:94 Identity:27/94 - (28%)
Similarity:48/94 - (51%) Gaps:4/94 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 DRVKRPMNAFMVWSRGQRRKMASDNPKMHN-SEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHM 240
            ::.|||.:||.|:....|.....::||..: :.:.|..|.:||.||:|||.|::.:|.:.:..:.
plant    33 NKPKRPSSAFFVFMEDFRVTYKEEHPKNKSVAAVGKAGGEKWKSLSDSEKAPYVAKADKRKVEYE 97

  Fly   241 KEHPDYKYR---PRRKTKTLTKTKEKYPM 266
            |....|..:   ..||.:.||...::..|
plant    98 KNMKAYNKKLVIALRKMRNLTSQFQRLTM 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 22/71 (31%)
HMGB3NP_001031075.1 HMGB-UBF_HMG-box 35..101 CDD:238686 21/65 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.