powered by:
Protein Alignment SoxN and HMGB5
DIOPT Version :9
Sequence 1: | NP_001260269.1 |
Gene: | SoxN / 44275 |
FlyBaseID: | FBgn0029123 |
Length: | 761 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001329802.1 |
Gene: | HMGB5 / 829709 |
AraportID: | AT4G35570 |
Length: | 125 |
Species: | Arabidopsis thaliana |
Alignment Length: | 77 |
Identity: | 19/77 - (24%) |
Similarity: | 41/77 - (53%) |
Gaps: | 4/77 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 171 KNQQHADRVKRPMNAFMVWSRGQRRKMASDNPKMHN-SEISKRLGAQWKDLSESEKRPFIDEAKR 234
|..:..:|.|:|.:.|.|:....|::....||...: ..:.:..|.:||.::|.|:.||:.:::.
plant 26 KKTKDPNRPKKPPSPFFVFLDDFRKEFNLANPDNKSVGNVGRAAGKKWKTMTEEERAPFVAKSQS 90
Fly 235 LR---AVHMKEH 243
.: ||.|:::
plant 91 KKTEYAVTMQQY 102
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1641977at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.