DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and sox1

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_001074465.1 Gene:sox1 / 779569 XenbaseID:XB-GENE-1018269 Length:401 Species:Xenopus tropicalis


Alignment Length:438 Identity:172/438 - (39%)
Similarity:202/438 - (46%) Gaps:112/438 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 SHQQHTQQQQHGQQQHLGAGSALSSLTGGSSNNNNNSATANKNQQHADRVKRPMNAFMVWSRGQR 194
            |....|.....|.|.....|.     |||...|..|.          ||||||||||||||||||
 Frog     3 SMMMETDLHSPGVQPPSNTGQ-----TGGGGGNKANQ----------DRVKRPMNAFMVWSRGQR 52

  Fly   195 RKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMKEHPDYKYRPRRKTKTLTK 259
            ||||.:|||||||||||||||:||.:||:||||||||||||||:|||||||||||||||||||.|
 Frog    53 RKMAQENPKMHNSEISKRLGAEWKVMSEAEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLLK 117

  Fly   260 TKEKYPM-GGLMPGQTVGGGAPGEPVTPTRVQGQPG----QNQSLNGSGGSA------------- 306
             |:||.: |||:  ...|||..|..::|....|..|    |.....|||.||             
 Frog   118 -KDKYSLAGGLL--HAAGGGHMGVGLSPGGGGGGTGGVVVQRLESPGSGASAGGYAHMNGWANGA 179

  Fly   307 ---AAAAAAAAAAAQQAR----QDMYQMNAPNGYMPNGYMMHADPAGAAAYQTSYMGQHY----- 359
               :.|||||||..|:|:    |...|.....|:.|:.:..|       .:...:...|:     
 Frog   180 YPGSVAAAAAAAMMQEAQLAYSQQQQQHPGSGGHHPHHHPHH-------PHHHPHHHPHHNPTPH 237

  Fly   360 -------AAQRYDMGHMYNNGYAMYQTVSGGQTSPYGSSLQQPGSPSPYG----GSSLQQQPGSP 413
                   ...||||..:      .|..:.|.||       ....|||.||    .||.||..|||
 Frog   238 PPPPPPQPMHRYDMSAL------QYSPLPGAQT-------YMTASPSGYGALGYSSSQQQHQGSP 289

  Fly   414 TPYGGGGGGGGQVSCQSHSPS----DSSIKSEP-VSPSPSAIALNNNNNINNNHIMKREYSS--- 470
            :............:..:.|.:    .|.:|||| |||..|....:|......:   .||..|   
 Frog   290 SSAAVAAAAAAAAAAAASSGALGALGSLVKSEPSVSPPVSGGGPHNRPPCPGD---LREMISMYL 351

  Fly   471 ---------AAAAAAAAAAAAAAGGGELNHLMNMYHLPDEQRHLLHYQ 509
                     ||||||||||||||       ...::.||.      |||
 Frog   352 PSGGEAGDPAAAAAAAAAAAAAA-------TSRLHSLPQ------HYQ 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 63/70 (90%)
sox1NP_001074465.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38 12/49 (24%)
SOX-TCF_HMG-box 36..107 CDD:238684 63/70 (90%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..249 6/58 (10%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 320..343 8/25 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X927
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.