DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and Hmgb4

DIOPT Version :10

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_081312.2 Gene:Hmgb4 / 69317 MGIID:1916567 Length:181 Species:Mus musculus


Alignment Length:83 Identity:22/83 - (26%)
Similarity:44/83 - (53%) Gaps:1/83 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 KRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMKEHP 244
            ::|.::|:::||.....:..:||.....:::|..|..|....|:||:|:..:|..:||.:.:|..
Mouse    94 RKPPSSFLLFSRDHYAMLKQENPDWTVVQVAKAAGKMWSTTDEAEKKPYEQKAALMRAKYFEEQE 158

  Fly   245 DYKYRPR-RKTKTLTKTK 261
            .|:.:.: ||...|...|
Mouse   159 AYRNQCQGRKGNFLESAK 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 HMG-box_SoxB 177..252 CDD:438790 18/72 (25%)
Hmgb4NP_081312.2 HMG-box_HMGB_rpt1 8..76 CDD:438794
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 80..100 1/5 (20%)
HMG-box_HMGB_rpt2 91..161 CDD:438795 17/66 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.