DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and Sox12

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_001162121.1 Gene:Sox12 / 689988 RGDID:1586313 Length:314 Species:Rattus norvegicus


Alignment Length:260 Identity:87/260 - (33%)
Similarity:125/260 - (48%) Gaps:40/260 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 VKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMKEH 243
            :|||||||||||:.:|||:....|.|||:|||||||.:|:.|.:|||.||:.||:|||..||.::
  Rat    40 IKRPMNAFMVWSQHERRKIMDQWPDMHNAEISKRLGRRWQLLQDSEKIPFVREAERLRLKHMADY 104

  Fly   244 PDYKYRPRRKTK-TLTKTKEKYPMGGLMPGQTVGGGA---PGEPVTPTRVQGQPGQNQSLNGSGG 304
            ||||||||:|:| ...|.:.:.|.||       |||:   || |..|    |:.|:    ..:||
  Rat   105 PDYKYRPRKKSKGAPAKARPRPPGGG-------GGGSRLKPG-PQLP----GRGGR----RATGG 153

  Fly   305 SAAAAAAAAAAAAQQARQDMYQMN------------APNGYMPNGYMMHA-----DPAGAAAYQT 352
            .....|||.....:...:::.::.            .|.|....|....|     :.|.|:|...
  Rat   154 PLGGGAAAPEDDDEDEEEELLEVRLLETPGRELWRMVPAGRAARGPAERAQGPSSEGAAASAASP 218

  Fly   353 SYMGQHYAAQRYDMGHMYNNGYAMYQTVSGGQTSPYGSSLQQPGSPSPYGGSSLQQQPGSPTPYG 417
            :........:..:.......|..  :||:.|: .|.|...:.|..|:....|:|.:.|....|.|
  Rat   219 TLSEDEEPEEEEEEAATAEEGEE--ETVASGE-EPLGFLSRMPPGPTGLDCSALDRDPDLLPPSG 280

  Fly   418  417
              Rat   281  280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 43/69 (62%)
Sox12NP_001162121.1 SOX-TCF_HMG-box 39..110 CDD:238684 43/69 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.