DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and SOX12

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_008874.2 Gene:SOX12 / 6666 HGNCID:11198 Length:315 Species:Homo sapiens


Alignment Length:285 Identity:90/285 - (31%)
Similarity:125/285 - (43%) Gaps:89/285 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 VKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMKEH 243
            :|||||||||||:.:|||:....|.|||:|||||||.:|:.|.:|||.||:.||:|||..||.::
Human    40 IKRPMNAFMVWSQHERRKIMDQWPDMHNAEISKRLGRRWQLLQDSEKIPFVREAERLRLKHMADY 104

  Fly   244 PDYKYRPRRKTKTLTKTKEKYPMGG------LMPG-QTVGGG---APGEPV-------------- 284
            ||||||||:|:|.........|.||      |.|| |..|.|   |.|.|:              
Human   105 PDYKYRPRKKSKGAPAKARPRPPGGSGGGSRLKPGPQLPGRGGRRAAGGPLGGGAAAPEDDDEDD 169

  Fly   285 -----------TPTR-----------VQGQPGQNQSLNGSGGSAAAAAAAAAAAAQQARQDMYQM 327
                       ||.|           .:||..:.|..:|.|.:|||||:...:..::..::    
Human   170 DEELLEVRLVETPGRELWRMVPAGRAARGQAERAQGPSGEGAAAAAAASPTPSEDEEPEEE---- 230

  Fly   328 NAPNGYMPNGYMMHADPAGAAAYQTSYMGQHYAAQRYDMGHMYNNGYAMYQTVSGGQTSPYGSSL 392
                           :...|||.:    |:.                   :||:.|:.| .|...
Human   231 ---------------EEEAAAAEE----GEE-------------------ETVASGEES-LGFLS 256

  Fly   393 QQPGSPSPYGGSSLQQQPGSPTPYG 417
            :.|..|:....|:|.:.|....|.|
Human   257 RLPPGPAGLDCSALDRDPDLQPPSG 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 43/69 (62%)
SOX12NP_008874.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 90/285 (32%)
SOX-TCF_HMG-box 39..110 CDD:238684 43/69 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..288 53/225 (24%)
Required for transcriptional activation activity and synergistic coactivation of transcriptional activity with POU3F2. /evidence=ECO:0000250|UniProtKB:Q04890 283..315
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1275
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.