DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and SOX15

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_008873.1 Gene:SOX15 / 6665 HGNCID:11196 Length:233 Species:Homo sapiens


Alignment Length:292 Identity:102/292 - (34%)
Similarity:122/292 - (41%) Gaps:113/292 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 AGSALSSLTGGSSNNNNNSATANKNQQHADRVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKR 212
            |.:|.:|.:.|........:.|.......::||||||||||||..|||:||..||||||||||||
Human    18 AATAAASSSSGPQEREGAGSPAAPGTLPLEKVKRPMNAFMVWSSAQRRQMAQQNPKMHNSEISKR 82

  Fly   213 LGAQWKDLSESEKRPFIDEAKRLRAVHMKEHPDYKYRPRRKTKTLTKTKEKYPMGGLMP---GQT 274
            ||||||.|.|.|||||::|||||||.|::::||||||||||.|:          .|..|   ||.
Human    83 LGAQWKLLDEDEKRPFVEEAKRLRARHLRDYPDYKYRPRRKAKS----------SGAGPSRCGQG 137

  Fly   275 VGGGAPGEPVTPTRVQGQPGQNQSLNGSGGSAAAAAAAAAAAAQQARQDMYQMNAPN---GYMPN 336
            .|..|.|.|               |.|.|                     |....|:   ||.| 
Human   138 RGNLASGGP---------------LWGPG---------------------YATTQPSRGFGYRP- 165

  Fly   337 GYMMHADPAGAAAYQTSYMGQHYAAQRYDMGHMYNNGYAMYQTVSGGQTSPYGSSLQQPGSPSPY 401
                       .:|.|:|:                             ...||||..:..:||| 
Human   166 -----------PSYSTAYL-----------------------------PGSYGSSHCKLEAPSP- 189

  Fly   402 GGSSLQQQ-----------------PGSPTPY 416
              .||.|.                 |||||||
Human   190 --CSLPQSDPRLQGELLPTYTHYLPPGSPTPY 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 54/70 (77%)
SOX15NP_008873.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48 5/29 (17%)
Required to promote HAND1 transcriptional activator activity. /evidence=ECO:0000250|UniProtKB:P43267 1..47 5/28 (18%)
SOX-TCF_HMG-box 48..119 CDD:238684 54/70 (77%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..153 22/85 (26%)
Interaction with FHL3. /evidence=ECO:0000250|UniProtKB:P43267 138..183 19/121 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..233 7/12 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.