DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and SOX10

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_008872.1 Gene:SOX10 / 6663 HGNCID:11190 Length:466 Species:Homo sapiens


Alignment Length:460 Identity:127/460 - (27%)
Similarity:183/460 - (39%) Gaps:128/460 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 SQVGQQQQQQQQQQSSPLHSSSELSPTQSSIGSHHMTSPVSHQ--QHTQQQQHGQQQH----LGA 148
            |.||.::.:.....|:|     .|.|.....||....||...:  :..::||.|:...    :..
Human    13 SPVGSEEPRCLSPGSAP-----SLGPDGGGGGSGLRASPGPGELGKVKKEQQDGEADDDKFPVCI 72

  Fly   149 GSALSSLTGGSS----------NNNNNSATANKNQQHADRVKRPMNAFMVWSRGQRRKMASDNPK 203
            ..|:|.:..|..          |.      |:|::.|   |||||||||||::..|||:|...|.
Human    73 REAVSQVLSGYDWTLVPMPVRVNG------ASKSKPH---VKRPMNAFMVWAQAARRKLADQYPH 128

  Fly   204 MHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMKEHPDYKYRP-RRKTKTLTKTKEKYPMG 267
            :||:|:||.||..|:.|:||:|||||:||:|||..|.|:||||||:| |||.....:.:.:.|.|
Human   129 LHNAELSKTLGKLWRLLNESDKRPFIEEAERLRMQHKKDHPDYKYQPRRRKNGKAAQGEAECPGG 193

  Fly   268 GLMPGQTV----------------GGGAP--------------GEPVTPT--RVQGQPGQ----- 295
            ....|.|.                |.|:|              |.|..||  :.:.|.|:     
Human   194 EAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPTPPTTPKTELQSGKADPKR 258

  Fly   296 -NQSLNGSG------GSAAAAAAAAAAAAQQARQDMYQMNAPNGYM-PNGYMMHADPAGAAAYQT 352
             .:|:...|      |:......:....:.....|:.:::.   |: |||:..|.....||.|. 
Human   259 DGRSMGEGGKPHIDFGNVDIGEISHEVMSNMETFDVAELDQ---YLPPNGHPGHVSSYSAAGYG- 319

  Fly   353 SYMGQHYAAQRYDMGH----MYNNGYAMYQTVS---------------GGQTSPYGSSLQQPGSP 398
              :|...|..   .||    ....|.|: .|||               |.|..|:.:  .||.:.
Human   320 --LGSALAVA---SGHSAWISKPPGVAL-PTVSPPGVDAKAQVKTETAGPQGPPHYT--DQPSTS 376

  Fly   399 S--------PYGGSSL-----------QQQPGSPTPYGGGGGGGGQVSCQSH-SPSDSSIKSEPV 443
            .        |:.||:.           ..||..|. ||..|...|..|..|: .||...:.:...
Human   377 QIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPY-YGHSGQASGLYSAFSYMGPSQRPLYTAIS 440

  Fly   444 SPSPS 448
            .||||
Human   441 DPSPS 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 44/70 (63%)
SOX10NP_008872.1 Sox_N 12..93 CDD:315171 17/84 (20%)
Dimerization (DIM). /evidence=ECO:0000303|PubMed:31194875 62..102 6/45 (13%)
SOX-TCF_HMG-box 103..173 CDD:238684 44/72 (61%)
Nuclear export signal 134..145 5/10 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..199 16/38 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..274 11/61 (18%)
Transactivation domain (TAM). /evidence=ECO:0000303|PubMed:31194875 228..310 14/84 (17%)
Transactivation domain (TAC). /evidence=ECO:0000303|PubMed:31194875 353..466 23/96 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 354..375 5/22 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 433..466 4/13 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..67 14/58 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.