DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and SOX5

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:XP_016875377.1 Gene:SOX5 / 6660 HGNCID:11201 Length:793 Species:Homo sapiens


Alignment Length:443 Identity:105/443 - (23%)
Similarity:167/443 - (37%) Gaps:118/443 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KGSLLHATMPPH-HTSAALHGHAASPYSALAPLMNLGQSHLTHSQLSHHNHHHHHMSAHIAASQS 72
            :|:|..|..|.. ||..:.:.........:|..:||.....|....|..:....||.| :..:..
Human   392 QGNLGAAVSPTSIHTDKSTNSPPPKSKDEVAQPLNLSAKPKTSDGKSPTSPTSPHMPA-LRINSG 455

  Fly    73 PNPL-SSLQSSMANT---------LNGSQVGQQQQQQQQQQSSPLHSSSELSPTQ----SSIGSH 123
            ..|| :|:.:::|:.         ||......:..|:.:|....|....::...:    :|:|.:
Human   456 AGPLKASVPAALASPSARVSTIGYLNDHDAVTKAIQEARQMKEQLRREQQVLDGKVAVVNSLGLN 520

  Fly   124 HMTS--------PVSHQQHTQQQQHGQQQHLGAGSALSSLTGGSSNNNNN-----SATANKNQQH 175
            :..:        .::.|...:|.:.|:..|......||..:.||:..:.:     |.....|:.|
Human   521 NCRTEKEKTTLESLTQQLAVKQNEEGKFSHAMMDFNLSGDSDGSAGVSESRIYRESRGRGSNEPH 585

  Fly   176 ADRVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHM 240
               :||||||||||::.:|||:....|.||||.|||.||::||.::..||:|:.:|..||...|:
Human   586 ---IKRPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKAMTNLEKQPYYEEQARLSKQHL 647

  Fly   241 KEHPDYKYRPRRKTKTLTKTKEKYPMGGLMPGQTVGGGAPGEPVTPTRVQGQPGQNQSLNGSGGS 305
            :::|||||:||.|...|...|:      |..|:                                
Human   648 EKYPDYKYKPRPKRTCLVDGKK------LRIGE-------------------------------- 674

  Fly   306 AAAAAAAAAAAAQQARQDMYQMNAPNGYMPNGYMMHADPAGAAAYQTSYMGQHYAAQRYDMGHMY 370
                   ..|..:..||:|.|      |...|.......|.|                   |.:|
Human   675 -------YKAIMRNRRQEMRQ------YFNVGQQAQIPIATA-------------------GVVY 707

  Fly   371 NNGYAMYQTVSGGQTSPYGSSLQQPGSPSPYGGSSLQQQPGSP---TPYGGGG 420
            ....||     .|..||:        .||.:...|...:||.|   :.||..|
Human   708 PGAIAM-----AGMPSPH--------LPSEHSSVSSSPEPGMPVIQSTYGVKG 747

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 36/70 (51%)
SOX5XP_016875377.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.