DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and SOX17

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_071899.1 Gene:SOX17 / 64321 HGNCID:18122 Length:414 Species:Homo sapiens


Alignment Length:375 Identity:115/375 - (30%)
Similarity:154/375 - (41%) Gaps:82/375 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 MTSP-----VSHQQHTQQQQHGQQQHLGAGSALSSLT--------GGSSNNNNNSATANKNQQHA 176
            |:||     ...|..||.........||......||:        |.:..|:...|.|....:..
Human     1 MSSPDAGYASDDQSQTQSALPAVMAGLGPCPWAESLSPIGDMKVKGEAPANSGAPAGAAGRAKGE 65

  Fly   177 DRVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMK 241
            .|::|||||||||::.:|:::|..||.:||:|:||.||..||.|:.:|||||::||:|||..||:
Human    66 SRIRRPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALTLAEKRPFVEEAERLRVQHMQ 130

  Fly   242 EHPDYKYRPRRK--TKTLTKTKEKY-------------PMGGLMPGQTVG------GGAPGEPVT 285
            :||:|||||||:  .|.|.:.:..:             |.||.:....:|      |...|.|:.
Human   131 DHPNYKYRPRRRKQVKRLKRVEGGFLHGLAEPQAAALGPEGGRVAMDGLGLQFPEQGFPAGPPLL 195

  Fly   286 PTRVQGQPGQNQSLNGSGGSAAAAAAAAAAAAQQARQDMYQMNAPNGYMPNGYMMHADPAGAAAY 350
            |..:.|.....|||..                  ...|.|.:..|:....:|  :..|||..|| 
Human   196 PPHMGGHYRDCQSLGA------------------PPLDGYPLPTPDTSPLDG--VDPDPAFFAA- 239

  Fly   351 QTSYMGQHYAAQRYDMGHMYNNGYAMYQTVSGGQTSPYGSSLQQPGSPSPYGGS--SLQQQP--- 410
              ...|...||..|        .||.....:|....|.|....:.| |.|.|.|  .|...|   
Human   240 --PMPGDCPAAGTY--------SYAQVSDYAGPPEPPAGPMHPRLG-PEPAGPSIPGLLAPPSAL 293

  Fly   411 -------GSPTPYGGGGGGGGQVSCQ-SHSPSDSSIKSEPVSPSPSAIAL 452
                   |||   |.|||.|.|:..| .|..........|..|||...||
Human   294 HVYYGAMGSP---GAGGGRGFQMQPQHQHQHQHQHHPPGPGQPSPPPEAL 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 40/70 (57%)
SOX17NP_071899.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 6/20 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..66 5/29 (17%)
SOX-TCF_HMG-box 67..138 CDD:238684 40/70 (57%)
Sox_C_TAD 201..412 CDD:288887 46/175 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 256..286 8/30 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..352 13/36 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.