DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and hmgb3a

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_001116308.1 Gene:hmgb3a / 561025 ZFINID:ZDB-GENE-050428-1 Length:213 Species:Danio rerio


Alignment Length:99 Identity:27/99 - (27%)
Similarity:49/99 - (49%) Gaps:17/99 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 KRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMKEHP 244
            |||.:.|.::....|.::.:..|.:...:::|:||..|..|:::.|:||:.:|.:|:..:.|:..
Zfish    93 KRPPSGFFLFCSEHRPQIKAQYPSLGIGDVAKKLGEMWNGLTDANKQPFLMKANKLKDKYQKDVA 157

  Fly   245 DYKYRPRRKTKTLTKTKE-------KYPMGGLMP 271
            |||          ||:|.       ..||...||
Zfish   158 DYK----------TKSKAGGVSMGMGMPMANCMP 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 20/68 (29%)
hmgb3aNP_001116308.1 HMG_box_2 7..78 CDD:286146
HMG_box 92..159 CDD:278906 17/65 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.