DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and hmgb3a

DIOPT Version :10

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_001116308.1 Gene:hmgb3a / 561025 ZFINID:ZDB-GENE-050428-1 Length:213 Species:Danio rerio


Alignment Length:99 Identity:27/99 - (27%)
Similarity:49/99 - (49%) Gaps:17/99 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 KRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMKEHP 244
            |||.:.|.::....|.::.:..|.:...:::|:||..|..|:::.|:||:.:|.:|:..:.|:..
Zfish    93 KRPPSGFFLFCSEHRPQIKAQYPSLGIGDVAKKLGEMWNGLTDANKQPFLMKANKLKDKYQKDVA 157

  Fly   245 DYKYRPRRKTKTLTKTKE-------KYPMGGLMP 271
            |||          ||:|.       ..||...||
Zfish   158 DYK----------TKSKAGGVSMGMGMPMANCMP 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 HMG-box_SoxB 177..252 CDD:438790 20/71 (28%)
hmgb3aNP_001116308.1 HMG-box_HMGB_rpt1 8..76 CDD:438794
HMG-box_HMGB_rpt2 90..160 CDD:438795 18/66 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.