DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and sox14

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_001032769.1 Gene:sox14 / 557661 ZFINID:ZDB-GENE-051113-268 Length:238 Species:Danio rerio


Alignment Length:308 Identity:123/308 - (39%)
Similarity:155/308 - (50%) Gaps:83/308 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 ADRVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHM 240
            ||.:|||||||||||||||||||.:|||||||||||||||:||.||||||||:|||||||||.||
Zfish     5 ADHIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSESEKRPYIDEAKRLRAQHM 69

  Fly   241 KEHPDYKYRPRRKTKTLTKTKEKY--PMGGLMPGQTVGGGAPGEPVTPTRVQGQPGQNQSLNGSG 303
            |||||||||||||.|.|.| |::|  |:..|  |.|  ....|.||:.|         .||.|| 
Zfish    70 KEHPDYKYRPRRKPKNLLK-KDRYVFPLPYL--GDT--DHLKGLPVSAT---------DSLLGS- 119

  Fly   304 GSAAAAAAAAAAAAQQARQDMYQMNAPNGYMPNGYMMHADPA--GAAAYQTSYMGQHYAAQRYDM 366
                         :::||..:...:||..::        ||:  .::|.|          :..:|
Zfish   120 -------------SEKARAFLPPTSAPYSFL--------DPSQFSSSAIQ----------KMTEM 153

  Fly   367 GHMYNNGYAMYQTVSGGQTSPYGSSLQQPGSPSPYGGSSLQQQPGSPTPYGGGGGGGGQVSCQSH 431
            .|........|.:..|.|...:||.    |.||.:  :.....|.:|         |..|.|...
Zfish   154 PHTLATSTLPYASSLGYQNGAFGSL----GCPSQH--THTHPSPTNP---------GYVVPCNCT 203

  Fly   432 SPSDSSIKSEPVS----PSPSAIALNNNNNINNNHIMKREYSSAAAAA 475
            :.|.||:: .||:    |..:...::             .||||.|||
Zfish   204 AWSASSLQ-PPVAYILFPGMTKSGID-------------PYSSAHAAA 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 62/70 (89%)
sox14NP_001032769.1 SOX-TCF_HMG-box 7..78 CDD:238684 62/70 (89%)
SOXp 77..>95 CDD:289133 11/18 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.