DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and SOX18

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_060889.1 Gene:SOX18 / 54345 HGNCID:11194 Length:384 Species:Homo sapiens


Alignment Length:311 Identity:96/311 - (30%)
Similarity:136/311 - (43%) Gaps:95/311 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 SATANKNQQHAD--RVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPF 228
            |......:|.||  |::|||||||||::.:|:::|..||.:||:.:||.||..||:|:.:|||||
Human    70 SPAGRGERQAADESRIRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGKAWKELNAAEKRPF 134

  Fly   229 IDEAKRLRAVHMKEHPDYKYRPRRKTKTLTKTKEKYPMGGLMPGQTVGGGAPGEP---------- 283
            ::||:|||..|:::||:|||||||| |...|.:.      |.||..:.|.||.:|          
Human   135 VEEAERLRVQHLRDHPNYKYRPRRK-KQARKARR------LEPGLLLPGLAPPQPPPEPFPAASG 192

  Fly   284 -------VTPTRVQ----GQPGQNQS-LNGSGGSAAAAAAAAAAAAQQARQDMYQMNAPNGYMPN 336
                   :.|...:    |.|...:| |:|.....||.....||....|   :....||  |.|.
Human   193 SARAFRELPPLGAEFDGLGLPTPERSPLDGLEPGEAAFFPPPAAPEDCA---LRPFRAP--YAPT 252

  Fly   337 GYMMHADPAG------AAAYQTSYMGQHYAAQRYDMGHMYNNGYAMYQTVSGGQTSPYGSSLQQP 395
              .:..||.|      |.|.:|       |.....:..:|                 ||:.    
Human   253 --ELSRDPGGCYGAPLAEALRT-------APPAAPLAGLY-----------------YGTL---- 287

  Fly   396 GSPSPYGGSSLQQQPGSPTPYGGGGGGGGQVSCQSHSPSDSSIKSEPVSPS 446
            |:|.||.|      |.||.|              ...|.:|   :||:.|:
Human   288 GTPGPYPG------PLSPPP--------------EAPPLES---AEPLGPA 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 38/70 (54%)
SOX18NP_060889.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..88 5/17 (29%)
SOX-TCF_HMG-box 84..155 CDD:238684 38/70 (54%)
Interaction with DNA. /evidence=ECO:0000250|UniProtKB:P43680 87..100 9/12 (75%)
Interaction with DNA. /evidence=ECO:0000250|UniProtKB:P43680 111..123 6/11 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..218 22/78 (28%)
Important for transcriptional activation. /evidence=ECO:0000250|UniProtKB:P43680 166..231 15/70 (21%)
Sox_C_TAD 193..382 CDD:288887 39/181 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..312 9/41 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.