DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and Hmgb1l5

DIOPT Version :10

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_001417261.1 Gene:Hmgb1l5 / 497907 RGDID:1563668 Length:211 Species:Rattus norvegicus


Alignment Length:85 Identity:21/85 - (24%)
Similarity:44/85 - (51%) Gaps:2/85 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 KRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMKEHP 244
            |.|.:||.::....|.|:..::|.:...::.|:||..|.:.:..:|:|:...|.:|:..:.|:..
  Rat    96 KTPPSAFFLFCSEYRPKIKGEHPGLSIGDVVKKLGEMWTNTAADDKQPYEKMAAKLKEKYEKDIA 160

  Fly   245 DY--KYRPRRKTKTLTKTKE 262
            .|  |.:|....|.:.|.::
  Rat   161 AYRAKGKPDAAKKGVVKAEK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 HMG-box_SoxB 177..252 CDD:438790 19/73 (26%)
Hmgb1l5NP_001417261.1 None

Return to query results.
Submit another query.