DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and hmgb2b

DIOPT Version :10

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_001004674.1 Gene:hmgb2b / 447936 ZFINID:ZDB-GENE-040912-122 Length:214 Species:Danio rerio


Alignment Length:108 Identity:31/108 - (28%)
Similarity:45/108 - (41%) Gaps:31/108 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 KRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMKEHP 244
            |||.:||.|:....|..:.|::|.:...||:|:||..|...|..::.||..:|.:||..:.||..
Zfish    98 KRPPSAFFVFCSEYRPTVKSEHPNLTIGEIAKKLGELWSKQSSKDRAPFEQKAGKLREKYEKEVA 162

  Fly   245 DYKYRPRRKTKTLTKTKEKYPMGGLMPGQTVGGGA----PGEP 283
            .|:                           .||||    ||.|
Zfish   163 AYR---------------------------AGGGASKRGPGRP 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 HMG-box_SoxB 177..252 CDD:438790 24/71 (34%)
hmgb2bNP_001004674.1 HMG-box_HMGB_rpt1 8..76 CDD:438794
HMG-box_HMGB_rpt2 95..165 CDD:438795 23/66 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.