DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and Sox102F

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster


Alignment Length:456 Identity:115/456 - (25%)
Similarity:166/456 - (36%) Gaps:163/456 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SPYSALAPLMNLGQSHLTHSQLSHHNHHHHHMSAHIAASQSPNPLSSLQSSMANTLNGSQVGQQQ 96
            ||.....|...|..||.|..:..|..      :|..:.:.||:|..:|           .:....
  Fly   231 SPTYENPPYEILSYSHNTPPESPHGR------TADCSKNFSPSPTDNL-----------SIASVS 278

  Fly    97 QQQQQQQSSPLH-----SSSELSPTQSSIGSH--HMTSPVSH---QQHTQQQQHGQ------QQH 145
            :.|..:..:||:     .|...||..||...|  ::|..||.   ..|..|..:.:      :.|
  Fly   279 EAQDSEMDAPLNLSKPKGSPSSSPNSSSQRDHCENLTPVVSSPPLSWHQGQPHYAEIELPLLKSH 343

  Fly   146 LGAGSALSSLTGGS-----SNNNNNSATANKNQQHA----------------------------- 176
            ....::..:.:|||     |.::.||...|..:..|                             
  Fly   344 GRVWNSAVACSGGSRATRVSRDSVNSCGTNSERSAALDPESLNSGQLGPVPASPSSQPLRQGNGH 408

  Fly   177 ------------DRVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFI 229
                        ..:||||||||||::.:|||:....|.||||.|||.|||:||.:|.::|:|:.
  Fly   409 GHGGNHGHVHSKPHIKRPMNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADKQPYY 473

  Fly   230 DEAKRLRAVHMKEHPDYKYRPRRKTKTLTKTKE----KYPM----------------GGLMPGQT 274
            :|..||..:||::||||:||||.|...:...|:    :|.:                ||      
  Fly   474 EEQSRLSKLHMEQHPDYRYRPRPKRTCIVDGKKMRISEYKVLMRNRRAEMRQLWCRTGG------ 532

  Fly   275 VGGGAPGEPVTPTRVQGQPGQNQSLNGSGGSAAAAAAAAAAAAQQARQDMYQMNAPNGYMPNGYM 339
            |.||:           |....:....|||||.:..|.|||||       :|.:.           
  Fly   533 VSGGS-----------GSLCADACPKGSGGSNSQVAVAAAAA-------VYHLQ----------- 568

  Fly   340 MHADPAGAAAYQTSYMGQHYAAQRYDMGHMYNNGYAMYQTVSGGQTSPYGSSLQQPGSPSPYGGS 404
               |.|.:||         ..|..:|.||                 :|.......|.|.||.|.|
  Fly   569 ---DMASSAA---------STAHGHDCGH-----------------TPPQQFFYPPESLSPSGFS 604

  Fly   405 S 405
            |
  Fly   605 S 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 38/70 (54%)
Sox102FNP_001014695.1 SOX-TCF_HMG-box 422..493 CDD:238684 38/70 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451305
Domainoid 1 1.000 46 1.000 Domainoid score I3058
eggNOG 1 0.900 - - E1_KOG0527
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.