DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and TFAM

DIOPT Version :10

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster


Alignment Length:60 Identity:16/60 - (26%)
Similarity:26/60 - (43%) Gaps:4/60 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 GKTLNRFHSALILRATFLPIVHRDNCQKAYRRTHTISEMMLCAGFFEGGHDSCQGDSGGP 217
            ||.:.|.|..|:...||:..:..   :...||...::|:.:.||.......:..|| |.|
  Fly  1208 GKQIIREHYQLLPGTTFIQTIPN---EVPVRRGEHVTEVKIGAGAGRSKDPAADGD-GDP 1263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 HMG-box_SoxB 177..252 CDD:438790 9/41 (22%)
TFAMNP_732527.1 HMG-box_SF 78..138 CDD:469606
HMG-box_SF 168..263 CDD:469606
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.