DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and sox21b

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_001009888.1 Gene:sox21b / 406246 ZFINID:ZDB-GENE-040429-1 Length:245 Species:Danio rerio


Alignment Length:280 Identity:113/280 - (40%)
Similarity:136/280 - (48%) Gaps:95/280 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 DRVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMK 241
            |.|||||||||||||.||||||.:|||||||||||||||:||.|:||||||||||||||||:|||
Zfish     6 DHVKRPMNAFMVWSRAQRRKMAQENPKMHNSEISKRLGAEWKLLTESEKRPFIDEAKRLRAMHMK 70

  Fly   242 EHPDYKYRPRRKTKTLTKTKEK--YPMGGLMPGQTVG-------GGAPGEPVTPTRVQGQPGQNQ 297
            ||||||||||||.|||.| |:|  :|:     ...:|       ||.|...:|           :
Zfish    71 EHPDYKYRPRRKPKTLMK-KDKFAFPV-----AYNLGEHEALKVGGLPAGALT-----------E 118

  Fly   298 SLNGSGGSAAAAAAAAAAAAQQARQDMYQMNAPNGYMPNGYMMHADPAGAAAYQTSYMGQHYAAQ 362
            ||..:...||||||||||                       .:..:|:.:|              
Zfish   119 SLMSNPDKAAAAAAAAAA-----------------------RVFFNPSMSA-------------- 146

  Fly   363 RYDMGHMYNNGYAMYQTVSGGQTSPYGSSLQQPGSPSPYGGSSLQQQPGSPTPYGGGGGGGGQVS 427
                     |.|:.:.         .||.:.:...|| :..:|....|.:.|.:.|..|||....
Zfish   147 ---------NPYSFFD---------LGSKMTELSPPS-FSYASPLGYPTAATAFSGAVGGGAHTH 192

  Fly   428 CQSHSPSDSSIKSEPVSPSP 447
            ..||             |||
Zfish   193 THSH-------------PSP 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 62/70 (89%)
sox21bNP_001009888.1 SOX-TCF_HMG-box 7..78 CDD:238684 62/70 (89%)
SOXp 77..>95 CDD:289133 12/18 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.