DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and D

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster


Alignment Length:450 Identity:155/450 - (34%)
Similarity:191/450 - (42%) Gaps:149/450 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MESDMKGSLLHATMPPHHTSAALHGHAASPYSALAPLMNLGQSHLTHSQLSHHNHHHHHMSAHIA 68
            |:.|:|..|        |.|.:|.....||.......:| |.|.:.|...||...||.|.:  ::
  Fly    35 MDMDIKRVL--------HYSQSLAAMGGSPNGPAGQGVN-GSSGMGHHMSSHMTPHHMHQA--VS 88

  Fly    69 ASQSPNPLSSLQSSMANTLNGSQVGQQQQQQQQQQSSPLHSSSELSPTQSSIGSHHMTSPVSHQQ 133
            |.|:.:|.||:.|  |.:|.                           :|||:||:          
  Fly    89 AQQTLSPNSSIGS--AGSLG---------------------------SQSSLGSN---------- 114

  Fly   134 HTQQQQHGQQQHLGAGSALSSLTGGSSNNNNNSATANKNQQHADRVKRPMNAFMVWSRGQRRKMA 198
                           ||.|:|.:|..|...::.||:...:.|   :||||||||||||.|||::|
  Fly   115 ---------------GSGLNSSSGHQSAGMHSLATSPGQEGH---IKRPMNAFMVWSRLQRRQIA 161

  Fly   199 SDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMKEHPDYKYRPRRKTKT-LTKTKE 262
            .||||||||||||||||:||.|:||||||||||||||||:|||||||||||||||.|. ||..  
  Fly   162 KDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKEHPDYKYRPRRKPKNPLTAG-- 224

  Fly   263 KYPMGGLM--------------PGQTVGGGAPGEPVTPTRV------QGQPGQNQSLNGSGGSAA 307
              |.|||.              ||...||..|...:.|...      ||.|     :...||...
  Fly   225 --PQGGLQMQAGGMGQQKLGAGPGAGAGGYNPFHQLPPYFAPSHHLDQGYP-----VPYFGGFDP 282

  Fly   308 AA--------AAAAAAAAQQARQDMYQMNAPNGYMPNGYMMHADPAGAAAYQTSYMG----QHYA 360
            .|        ||||||...|.:|   |..||....|...        ::.|...|.|    ..||
  Fly   283 LALSKLHQSQAAAAAAVNNQGQQ---QGQAPPQLPPTSL--------SSFYSGIYSGISAPSLYA 336

  Fly   361 AQRYDMGHMYNNGYAMYQTVSGGQTSPYGSSLQQPGSPSPYGGSSLQQQPGSPTPYGGGG 420
            |...:...:|.:                 ||...|||           .||:.||.|..|
  Fly   337 AHSANAAGLYPS-----------------SSTSSPGS-----------SPGTITPNGMDG 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 60/70 (86%)
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 61/73 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I4418
eggNOG 1 0.900 - - E1_KOG0527
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1275
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.