DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and sox17b.1

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_988849.1 Gene:sox17b.1 / 394440 XenbaseID:XB-GENE-484865 Length:376 Species:Xenopus tropicalis


Alignment Length:362 Identity:94/362 - (25%)
Similarity:153/362 - (42%) Gaps:84/362 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 IGSHHMTSPVSHQQHTQQQQHGQQQHLGAGSALSSLTGGSSNNNNNSATANKNQQHADRVKRPMN 184
            :|.:..|.|::..|..:.::.       ||||          |:...|.|        |::||||
 Frog    24 MGQYEWTDPLTMFQDAKTKKE-------AGSA----------NSRGKAEA--------RIRRPMN 63

  Fly   185 AFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMKEHPDYKYR 249
            |||||::.:|:::|..||.:||:|:||.||..||.|:.:.||||::||:|||..|::::||||||
 Frog    64 AFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKSLTLASKRPFVEEAERLRVQHIQDYPDYKYR 128

  Fly   250 PRRK--TKTLTKTKEKYPMGGLMPGQTVGGGAPGEPVTPTRVQGQPGQNQSLNGSGGSAAAAAAA 312
            ||||  .|.:.:.:|.:.....:||..|.|           .....|||..:..||.::..:...
 Frog   129 PRRKKQVKRMKREEEGFLPSADIPGPQVMG-----------CNAMVGQNYKMQYSGQNSQQSQIT 182

  Fly   313 AAAAAQQARQDMYQ---MNAPNGYMPNGYMMHADPAGAAAYQTSYMGQHYAAQRYDMGHMYNNGY 374
            .|...:......|.   .|.|..||.....:...|.....||.             :.:.:|:.|
 Frog   183 PAGYFEDHNPVGYYYRGYNVPEYYMSQNSSVTCGPPAQGEYQA-------------LSYNFNSSY 234

  Fly   375 AMYQTVSGGQTSPYGSSLQQPGSPSPYGGSSLQQQPG--------SPTPYGGGGGGGGQVSCQSH 431
            ..||         ..:|....|.......:.:|:.|.        ||..|.|          |.:
 Frog   235 IPYQ---------QNASAPAMGKQMAVKENIIQESPEHGIMGCQVSPQMYNG----------QMY 280

  Fly   432 SPSDSSIKSEPVSPSPSAIALNNNNN-INNNHIMKRE 467
            .|  ...|:.||:.:....:|:.:.. :..|::..::
 Frog   281 VP--ECAKTHPVAQTEQHSSLHQSQQMVTQNYLPSQQ 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 38/70 (54%)
sox17b.1NP_988849.1 SOX-TCF_HMG-box 57..128 CDD:238684 38/70 (54%)
PABP-1234 <80..250 CDD:130689 58/202 (29%)
Required for transcriptional activity and interaction with ctnnb1. /evidence=ECO:0000250|UniProtKB:O42601 327..331
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.