DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and sox4b

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_957195.1 Gene:sox4b / 393875 ZFINID:ZDB-GENE-040426-1274 Length:342 Species:Danio rerio


Alignment Length:319 Identity:94/319 - (29%)
Similarity:143/319 - (44%) Gaps:67/319 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 HLGAGSALSSLTGGSSNNNNNSATANKNQQHADRVKRPMNAFMVWSRGQRRKMASDNPKMHNSEI 209
            |..:.|..|:.:||...|.....||      :..:|||||||||||:.:|||:...:|.|||:||
Zfish    27 HAASPSPGSTASGGEKLNPGWCKTA------SGHIKRPMNAFMVWSQIERRKIMEQSPDMHNAEI 85

  Fly   210 SKRLGAQWKDLSESEKRPFIDEAKRLRAVHMKEHPDYKYRPRRKTKTL-TKTKEKYPMGGLMPGQ 273
            |||||.:||.|.:.:|.|||.||:|||..||.::||||||||:|.|:. :|..||..:       
Zfish    86 SKRLGKRWKLLKDGDKIPFIREAERLRLKHMADYPDYKYRPRKKVKSSGSKPSEKLSI------- 143

  Fly   274 TVGGGAPGEPVTPTRVQGQPGQNQSLNGSGGSAAAAAAAAAAAAQQA---RQDMYQMNAPNGYMP 335
                   .:|.:..|..|:|.:.:.  |.....:...|.||...:|:   ::.:|..::.:.  |
Zfish   144 -------SKPSSKKRSAGKPHKKEP--GPADHHSLYKAKAAPVVKQSPEKKKRLYIFSSSSS--P 197

  Fly   336 NGYMMHADPAGAAAYQTSYMGQHYAAQRYDMGHMYNNGYAMYQTVSG-----GQTSPYGSSLQQP 395
            :...:.|.|..:::..||                  :..::|:..||     ..|...|||::.|
Zfish   198 SPAAVPASPTLSSSADTS------------------DPLSLYEDASGSGKEDADTRYTGSSMRAP 244

  Fly   396 GSPSPYGGSSLQQQPGSPTPYGGGGGGGGQVSCQSHSPSDSSIKSEPVSPSPSAIALNN 454
                            ||||.........|.|..|....|........||...:::|.:
Zfish   245 ----------------SPTPSAAHSSSSSQFSSSSDEEPDDDALDANTSPGFDSMSLGS 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 43/70 (61%)
sox4bNP_957195.1 SOX-TCF_HMG-box 54..125 CDD:238684 43/70 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.