DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and sox4a

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_998287.1 Gene:sox4a / 336346 ZFINID:ZDB-GENE-030131-8290 Length:363 Species:Danio rerio


Alignment Length:325 Identity:98/325 - (30%)
Similarity:148/325 - (45%) Gaps:49/325 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 QQQHLGAGSALSSLTGGSSNNN------NNSATANKNQQHADR------------VKRPMNAFMV 188
            :|.|..:.|:...|.|.|.::.      :.|.|........|:            :|||||||||
Zfish     9 EQTHTSSSSSSDVLPGDSIDSGEMDLDMDASPTPGSPNSAGDKMDIAWCKTPSGHIKRPMNAFMV 73

  Fly   189 WSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMKEHPDYKYRPRRK 253
            ||:.:|||:...:|.|||:|||||||.:||.|.:|:|.|||.||:|||..||.::||||||||:|
Zfish    74 WSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHMADYPDYKYRPRKK 138

  Fly   254 TKTLT-KTKEKYPMGGLMPGQTVGGGAPGEPVTPTRVQGQPGQNQSLNGSGGSAAAAAAAAAAAA 317
            .|:.: ||.||.......||.........:.::.|..:....:..|.:......|...:.:.:||
Zfish   139 VKSSSGKTGEKAERVSASPGAKSASKKSSKTLSRTHRKSTTLELTSHSVPADHHALYKSRSVSAA 203

  Fly   318 QQARQDMYQMNAPNGYMPNGYMMHADPAGAAAYQTSYMGQHYAAQRYDMGHMYNNGYAMYQTVSG 382
            :|    :.:..|..|::..|....:.|...|...:..:..  :|:..|...:|.:|.|     ||
Zfish   204 KQ----IPEKPAKRGHVYGGCSTDSSPPSVAVPASPTLSS--SAESSDPLSLYEDGLA-----SG 257

  Fly   383 GQTSPYGSSLQQPGSPSPYGGSSLQQQPGSPTPYGGGGGGGGQVSCQSHSPSDSSIKSEPVSPSP 447
            .:.:...:..:...:|||        .|.:...|          |.|| |.||...:.|...|||
Zfish   258 KEDAEPAARFKYTRAPSP--------TPSASHSY----------SSQS-SSSDEEFEDELADPSP 303

  Fly   448  447
            Zfish   304  303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 44/82 (54%)
sox4aNP_998287.1 SOX-TCF_HMG-box 63..134 CDD:238684 44/70 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.