DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and hmgb1a

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_955849.2 Gene:hmgb1a / 321622 ZFINID:ZDB-GENE-030131-341 Length:205 Species:Danio rerio


Alignment Length:113 Identity:31/113 - (27%)
Similarity:50/113 - (44%) Gaps:23/113 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 KRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMKEHP 244
            |||.:||.::....|.|:..:.|.:...:::||||..|..:|..||:|:..:|.:|:..:.|:..
Zfish    95 KRPPSAFFIFCSEFRPKVKEETPGLSIGDVAKRLGEMWNKISSEEKQPYEKKAAKLKEKYEKDIA 159

  Fly   245 DYKYRPRRKTKTLTKTKEKYPMGGLMPGQTVGGGAPGEPVTPTRVQGQ 292
            .|    |.|.|                   |||||...|..|.:...:
Zfish   160 AY----RSKGK-------------------VGGGAAKAPSKPDKANDE 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 21/68 (31%)
hmgb1aNP_955849.2 HMG-box 7..77 CDD:320749
HMG_box 94..161 CDD:278906 20/65 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.