DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and HMGB1

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_001300821.1 Gene:HMGB1 / 3146 HGNCID:4983 Length:215 Species:Homo sapiens


Alignment Length:85 Identity:22/85 - (25%)
Similarity:47/85 - (55%) Gaps:2/85 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 KRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMKEHP 244
            |||.:||.::....|.|:..::|.:...:::|:||..|.:.:..:|:|:..:|.:|:..:.|:..
Human    96 KRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIA 160

  Fly   245 DY--KYRPRRKTKTLTKTKE 262
            .|  |.:|....|.:.|.::
Human   161 AYRAKGKPDAAKKGVVKAEK 180

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 19/70 (27%)