DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and Sox18

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_001019952.1 Gene:Sox18 / 311723 RGDID:1311718 Length:377 Species:Rattus norvegicus


Alignment Length:302 Identity:90/302 - (29%)
Similarity:137/302 - (45%) Gaps:83/302 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 QQHAD--RVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRL 235
            :|.||  |::|||||||||::.:|:::|..||.:||:.:||.||..||:|:.:|||||::||:||
  Rat    71 RQTADELRIRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGKAWKELNTAEKRPFVEEAERL 135

  Fly   236 RAVHMKEHPDYKYRPRRKTKTLTKTKEKYPMGGLMPGQTVGGGAPGEPVTPTRVQGQPGQNQSLN 300
            |..|:::||:|||||||| |...|.:...| |.|:|| .|...||.||.                
  Rat   136 RVQHLRDHPNYKYRPRRK-KQARKVRRLEP-GLLLPG-LVQPSAPPEPF---------------- 181

  Fly   301 GSGGSAAAAAAAAAAAAQQARQ------DMYQMNAPNGYMPNGYMMHADPAGAAAYQTSYMGQHY 359
                      |||:.:|:..|:      :...:..|.   |....:....:|.|::....:....
  Rat   182 ----------AAASGSARSFRELPTLGAEFDGLGLPT---PERSPLDGLESGEASFFPPPLAPED 233

  Fly   360 AAQRYDMGHMYNNGYAMYQTVSGGQTSPYGSSLQQ------PGSP--SPYGGSSLQQQPGSPTPY 416
            .|.|     .:...||  ..::...:..|||||.:      |.:|  ..|.|:.     |:|.|:
  Rat   234 CALR-----AFRAPYA--PELARDPSFCYGSSLAEALRTAPPAAPLAGLYYGTL-----GTPGPF 286

  Fly   417 GGGGGGGGQVSCQSHSPSDSSIKSEPVSPSPSAIALNNNNNI 458
                                   ..|:||.|.|.:|.....:
  Rat   287 -----------------------PNPLSPPPEAPSLEGTEQL 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 38/70 (54%)
Sox18NP_001019952.1 SOX-TCF_HMG-box 78..149 CDD:238684 38/70 (54%)
Sox17_18_mid 191..239 CDD:403331 7/55 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.