DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and SOX8

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_055402.2 Gene:SOX8 / 30812 HGNCID:11203 Length:446 Species:Homo sapiens


Alignment Length:472 Identity:124/472 - (26%)
Similarity:172/472 - (36%) Gaps:140/472 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 AASQSPNPLSSLQSSMANTLNGSQVGQQQQQQQQQQSSPLHSSSE-LSPTQSSIG--------SH 123
            |.||.|...|...|||::.           :.....:.|..:.|| |.....::|        :.
Human     7 ARSQPPCSPSGTASSMSHV-----------EDSDSDAPPSPAGSEGLGRAGVAVGGARGDPAEAA 60

  Fly   124 HMTSPVSHQQHTQQQQHGQQQHL-------GAGSALSSLTGGSSNNNNNSATANKNQQHADRVKR 181
            ....|...:....|...|....|       |.|.||                  |.:.|   |||
Human    61 DERFPACIRDAVSQVLKGYDWSLVPMPVRGGGGGAL------------------KAKPH---VKR 104

  Fly   182 PMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMKEHPDY 246
            ||||||||::..|||:|...|.:||:|:||.||..|:.|||||||||::||:|||..|.|:||||
Human   105 PMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLSESEKRPFVEEAERLRVQHKKDHPDY 169

  Fly   247 KYRPRRKTKTLTKTKEK--------YPMGGLM----------------PGQTVGGGAPGEPVTPT 287
            ||:|||:........:.        :|.||.:                .|||  .|.|..|.||.
Human   170 KYQPRRRKSAKAGHSDSDSGAELGPHPGGGAVYKAEAGLGDGHHHGDHTGQT--HGPPTPPTTPK 232

  Fly   288 RVQGQPGQNQSLNGSGGSAAAAA----------AAAAAAAQQARQDMYQMNAPNGYMPNGYMMHA 342
            ....|.|....|...|.....:.          .:..::......|.:.::..:.|:|.|.....
Human   233 TELQQAGAKPELKLEGRRPVDSGRQNIDFSNVDISELSSEVMGTMDAFDVHEFDQYLPLGGPAPP 297

  Fly   343 DPAGAAAYQTSYMGQHYAAQRYDMG--HMYNNGYAMYQTVSGGQTSP--------------YGSS 391
            :|           ||.|....:..|  .::.:..|...:.|..:|.|              ||. 
Human   298 EP-----------GQAYGGAYFHAGASPVWAHKSAPSASASPTETGPPRPHIKTEQPSPGHYGD- 350

  Fly   392 LQQPGSPSPYGGSSLQQQ--PGSPT-PYGGGGGGGGQVSCQS------------------HSPSD 435
             |..|||. ||..|.|..  |.:|. |:.|..|..|.:...|                  |||  
Human   351 -QPRGSPD-YGSCSGQSSATPAAPAGPFAGSQGDYGDLQASSYYGAYPGYAPGLYQYPCFHSP-- 411

  Fly   436 SSIKSEPVSPSPSAIAL 452
               :....||..:.:||
Human   412 ---RRPYASPLLNGLAL 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 45/70 (64%)
SOX8NP_055402.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58 13/61 (21%)
Sox_N 18..89 CDD:315171 12/81 (15%)
Dimerization (DIM). /evidence=ECO:0000303|PubMed:31194875 58..100 9/59 (15%)
SOX-TCF_HMG-box 101..171 CDD:238684 45/72 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..259 30/105 (29%)
Transactivation domain (TAM). /evidence=ECO:0000303|PubMed:31194875 224..298 12/73 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..378 17/62 (27%)
Transactivation domain (TAC). /evidence=ECO:0000303|PubMed:31194875 335..446 24/99 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 425..446 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.