DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and Hmgxb4

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_001100882.1 Gene:Hmgxb4 / 307667 RGDID:1305783 Length:598 Species:Rattus norvegicus


Alignment Length:284 Identity:54/284 - (19%)
Similarity:101/284 - (35%) Gaps:68/284 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 QSHLTHSQLSHHNHHHHHMS-----AHIAASQSPNP-------------LSSLQSSMANTLNGSQ 91
            ||.|..::..|.:....|.|     .....||.|.|             |...:||.|..|...:
  Rat   242 QSLLKTARKKHKSSSDSHSSPGPEGCGSDGSQLPEPHSANLDITGLDPILVESESSSAGELEAGE 306

  Fly    92 V-----------GQQQQQQQQQQSSPLHSSSELSPTQSSIGSHHMTSPVSHQQHTQQQQHGQQQH 145
            :           .::.::.::::....|.....|.|:.|....|.|:               ::|
  Rat   307 LVIDDSYREIKKKKKSKKSKKKKDKDRHKEKRHSRTKRSSTREHGTA---------------REH 356

  Fly   146 LGAGSALSSL---------TGGSSNNNNNSATANKNQQHADRVKRP-MNAFMVWSRGQRRKMASD 200
            :...|..||:         |.|...........::.::..::.|:. |:|:.|:.:..|..:.:|
  Rat   357 MLVSSPASSIPTLPLPALHTDGHGEKKKKKEEKDRERERGEKPKKKNMSAYQVFCKEYRVTIVAD 421

  Fly   201 NPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMKEHPDYKYRPRRKTKTLTKTKEKYP 265
            :|.:...|:||:|...||.|.|.:|            :..|:...|....:.|.:..|..::...
  Rat   422 HPGIDFGELSKKLAEVWKQLPEKDK------------LIWKQKAQYLQHKQNKAEATTVKRKASS 474

  Fly   266 MGGLMP--GQTVGGGAPGEPVTPT 287
            ..|.|.  ..:||..:|.:...||
  Rat   475 AEGTMKVRASSVGILSPQKKSPPT 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 18/71 (25%)
Hmgxb4NP_001100882.1 DUF4171 107..225 CDD:290491
HMG-box 400..463 CDD:238037 18/74 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.