DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and sox11b

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_571412.1 Gene:sox11b / 30603 ZFINID:ZDB-GENE-980526-466 Length:368 Species:Danio rerio


Alignment Length:312 Identity:83/312 - (26%)
Similarity:117/312 - (37%) Gaps:120/312 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 VKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMKEH 243
            :|||||||||||:.:|||:...:|.|||:|||||||.:||.|.:|||.|||.||:|||..||.::
Zfish    46 IKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLQHMADY 110

  Fly   244 PDYKYRPRRKTKTLTKTKEKYPMGGLMPGQTVGGGAPGEPVTPTRVQGQPGQNQSLNGSGGSAAA 308
            |||||||::|.|..:.:|                         ..||.....::|:..:.|...|
Zfish   111 PDYKYRPKKKPKLDSSSK-------------------------PAVQSPEKISKSVKAAAGKKCA 150

  Fly   309 -------AAAAAAAAAQQAR----------------------------------QDMYQMNAPNG 332
                   ....|.|:.|..|                                  :|.|:      
Zfish   151 KLKPSKPGNITARASTQDCRFNYVFTNLKVTKSIKRELTDDEDDDDDDDDDDDEEDDYE------ 209

  Fly   333 YMPNGYMMHADPAGAAAYQTSYMGQHYAAQRYDMGHMYNNGYAMYQTVSGGQTSPYGSSLQQ--- 394
                                            |..|:..:......|:|....|.:|:|:.:   
Zfish   210 --------------------------------DEEHIRLHNVPASPTLSSAAESEHGASMYEESR 242

  Fly   395 -----PGSPSPYGGSSLQQQ----PGSPTPYGGGGGGGGQVSCQSHSPSDSS 437
                 |||...|...::.:|    |.|.:|    ......||..|.|.|:.|
Zfish   243 HTSATPGSRLFYNFKNITKQSAAYPASVSP----ASSFRSVSSSSSSSSEDS 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 45/69 (65%)
sox11bNP_571412.1 SOX-TCF_HMG-box 45..112 CDD:238684 41/65 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.