DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and Sox14

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_001100320.1 Gene:Sox14 / 300954 RGDID:1309654 Length:240 Species:Rattus norvegicus


Alignment Length:311 Identity:117/311 - (37%)
Similarity:147/311 - (47%) Gaps:87/311 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 ADRVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHM 240
            :|.:|||||||||||||||||||.:|||||||||||||||:||.|||:||||:|||||||||.||
  Rat     5 SDHIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPYIDEAKRLRAQHM 69

  Fly   241 KEHPDYKYRPRRKTKTLTKTKEKY--PMGGLMPGQTVGGGAPGEPVTPTRVQGQPGQNQSLNGSG 303
            |||||||||||||.|.|.| |::|  |:..|  |.|          .|.:..|.|          
  Rat    70 KEHPDYKYRPRRKPKNLLK-KDRYVFPLPYL--GDT----------DPLKAAGLP---------- 111

  Fly   304 GSAAAAAAAAAAAAQQARQDMYQMNAPNGYMPNGYMMHADPAGAAAYQTSYMGQHYAAQRYDMGH 368
               ..|:....:|.::||..:...:||...:        |||..::.....||        ::.|
  Rat   112 ---VGASDGLLSAPEKARAFLPPASAPYSLL--------DPAQFSSSAIQKMG--------EVPH 157

  Fly   369 MYNNGYAMYQTVSGGQTSPYGSSLQQPGS-----PSPYGGSSLQQQPGSPTPYGGGGGGGGQVSC 428
            ........|.:..|.|...:| ||..|..     |||       ..||...|          .:|
  Rat   158 TLATSALPYASTLGYQNGAFG-SLSCPSQHTHTHPSP-------TNPGYVVP----------CNC 204

  Fly   429 QSHSPSDSSIKSEPVS----PSPSAIALNNNNNINNNHIMKREYSSAAAAA 475
            .:.|   :|....||:    |..:...::             .||||.|.|
  Rat   205 TAWS---ASTLQPPVAYILFPGMTKTGID-------------PYSSAHATA 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 61/70 (87%)
Sox14NP_001100320.1 SOX-TCF_HMG-box 7..78 CDD:238684 61/70 (87%)
SOXp 77..>118 CDD:403523 19/66 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.