DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and Hmgb2

DIOPT Version :10

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_058883.1 Gene:Hmgb2 / 29395 RGDID:69291 Length:210 Species:Rattus norvegicus


Alignment Length:104 Identity:28/104 - (26%)
Similarity:50/104 - (48%) Gaps:12/104 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 KRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMKEHP 244
            |||.:||.::....|.|:.|::|.:...:.:|:||..|.:.|..:|:|:..:|.:|:..:.|:..
  Rat    96 KRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIA 160

  Fly   245 DYKYRPRRKTKTLTKTKEKYPMGGLMPGQTVGGGAPGEP 283
            .|            :.|.|..:|...||:..|.....||
  Rat   161 AY------------RAKGKSEVGKKGPGRPTGSKKKNEP 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 HMG-box_SoxB 177..252 CDD:438790 20/71 (28%)
Hmgb2NP_058883.1 HMG-box_HMGB_rpt1 8..76 CDD:438794
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..102 3/5 (60%)
HMG-box_HMGB_rpt2 93..163 CDD:438795 20/78 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..210 9/38 (24%)
Required for chemotactic activity. /evidence=ECO:0000250|UniProtKB:P26583 165..180 5/14 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.