DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and Hmgb1

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:XP_038945039.1 Gene:Hmgb1 / 25459 RGDID:2802 Length:486 Species:Rattus norvegicus


Alignment Length:290 Identity:63/290 - (21%)
Similarity:96/290 - (33%) Gaps:64/290 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 AASPYSALAPLMNLGQSHLTHSQLSHHNHHHHH--MSAHIAASQSPNPLSSLQSSMANTLNGSQV 92
            ||.|..:.|.:.:........:.:|.|.|.|.|  ..:|....:...|.|...........|...
  Rat   126 AARPRPSPAAMASAPAPRPPRASVSSHTHIHTHTYTHSHARTHKGKEPYSRRARPRGGGGGGGAG 190

  Fly    93 GQQQQQQQQQQSSPLHSSSELSPTQSSIGSHHMTSPVSHQQHTQQ--QQHGQQQHLGAGSALSS- 154
            |:..|:       |..     :|..::.|.   .||     |.::  .:.|:|...|..|...| 
  Rat   191 GEDAQR-------PFR-----APALAAAGG---ASP-----HFERGFLRRGRQNGGGGASLRPSG 235

  Fly   155 --------------LTGGSSNNNNNSATANKNQQ--------HADRVKRPMNAFMVWSRGQRRKM 197
                          .|.|......|...|.:..|        ...|.|....||.|.:..:..|.
  Rat   236 RTWRPRARPEPQPPSTSGQVRRAGNPPRARQENQLNMGKGDPKKPRGKMSSYAFFVQTCREEHKK 300

  Fly   198 ASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMKEHPDYKYRPRRKTKTLTK--T 260
            ...:..::.||.||:...:||.:|..||..|.|.||..:|.:.:|...| ..|:.:||...|  .
  Rat   301 KHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTY-IPPKGETKKKFKDPN 364

  Fly   261 KEKYP--------------MGGLMPGQTVG 276
            ..|.|              :.|..||.::|
  Rat   365 APKRPPSAFFLFCSEYRPKIKGEHPGLSIG 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 22/70 (31%)
Hmgb1XP_038945039.1 HMG_box_2 277..349 CDD:401091 21/71 (30%)
HMG_box 366..433 CDD:395407 6/29 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.