DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and matmc_2

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_595867.1 Gene:matmc_2 / 2539619 PomBaseID:SPBC23G7.09 Length:181 Species:Schizosaccharomyces pombe


Alignment Length:82 Identity:25/82 - (30%)
Similarity:49/82 - (59%) Gaps:0/82 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 KNQQHADRVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRL 235
            |:....:|..||.|||:::.:.:...:...||.::||::||.:|..|::.|:..:..:...::..
pombe    95 KDTTSTERTPRPPNAFILYRKEKHATLLKSNPSINNSQVSKLVGEMWRNESKEVRMRYFKMSEFY 159

  Fly   236 RAVHMKEHPDYKYRPRR 252
            :|.|.|.:|.|||:||:
pombe   160 KAQHQKMYPGYKYQPRK 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 21/70 (30%)
matmc_2NP_595867.1 MATA_HMG-box 102..178 CDD:238685 24/75 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.