DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment SoxN and Sry

DIOPT Version :9

Sequence 1:	NP_001260269.1	Gene:	SoxN / 44275	FlyBaseID:	FBgn0029123	Length:	761	Species:	Drosophila melanogaster
Sequence 2:	NP_036904.1	Gene:	Sry / 25221	RGDID:	3759	Length:	169	Species:	Rattus norvegicus

Alignment Length:	77	Identity:	51/77 - (66%)
Similarity:	64/77 - (83%)	Gaps:	0/77 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   179 VKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMKEH 243
            ||||||||||||||:|||:|..||.|.||||||.||.|||.|:|:|||||..||:||:.:|.:::
  Rat     5 VKRPMNAFMVWSRGERRKLAQQNPSMQNSEISKHLGYQWKSLTEAEKRPFFQEAQRLKTLHREKY 69

  Fly   244 PDYKYRPRRKTK 255
            |:|||:|.|:.|
  Rat    70 PNYKYQPHRRVK 81

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
SoxN	NP_001260269.1	SOX-TCF_HMG-box	178..249	CDD:238684	47/69 (68%)
Sry	NP_036904.1	Sufficient for interaction with KPNB1. /evidence=ECO:0000250\|UniProtKB:Q05066	4..81		50/75 (67%)
		SOX-TCF_HMG-box	4..74	CDD:238684	46/68 (68%)
		Required for nuclear localization. /evidence=ECO:0000250\|UniProtKB:Q05066	6..22		14/15 (93%)
		Sufficient for interaction with EP300. /evidence=ECO:0000250\|UniProtKB:Q05066	52..84		15/30 (50%)
		Required for nuclear localization. /evidence=ECO:0000250\|UniProtKB:Q05066	75..81		2/5 (40%)
		Necessary for interaction with ZNF208 isoform KRAB-O. /evidence=ECO:0000250\|UniProtKB:Q05738	92..144
		Necessary for interaction with SLC9A3R2 and nuclear accumulation of SLC9A3R2. /evidence=ECO:0000250\|UniProtKB:Q05738	94..138
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	144..169
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000028
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	3	2.910