DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and Sox21

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_808421.1 Gene:Sox21 / 223227 MGIID:2654070 Length:276 Species:Mus musculus


Alignment Length:329 Identity:131/329 - (39%)
Similarity:146/329 - (44%) Gaps:122/329 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 DRVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMK 241
            |.|||||||||||||.||||||.:|||||||||||||||:||.|:||||||||||||||||:|||
Mouse     6 DHVKRPMNAFMVWSRAQRRKMAQENPKMHNSEISKRLGAEWKLLTESEKRPFIDEAKRLRAMHMK 70

  Fly   242 EHPDYKYRPRRKTKTLTKTKEKY----PMG----------GLMPGQTVGGGAPGEPVTPTRVQGQ 292
            ||||||||||||.|||.| |:|:    |.|          .|..|..:..||.|..|.       
Mouse    71 EHPDYKYRPRRKPKTLLK-KDKFAFPVPYGLGSVADAEHPALKAGAGLHAGAGGGLVP------- 127

  Fly   293 PGQNQSLNGSGGSAAAAAAAAAAAAQQARQDMYQMNAPNGYMPNGYMMHADPAGAAAYQTSYMGQ 357
                :||..:...||||||||||..               :.|......|..|.|||..:.|   
Mouse   128 ----ESLLANPEKAAAAAAAAAARV---------------FFPQSAAAAAAAAAAAAAGSPY--- 170

  Fly   358 HYAAQRYDMGHMYNNGYAMYQTVSGGQTSPYGSSLQQPGSPSPYGGSSLQQQPGSPTPYGGGGGG 422
                      .:.:.|..|.:..|.....||.|||                  |.||  .|.|..
Mouse   171 ----------SLLDLGSKMAEISSSSSGLPYASSL------------------GYPT--AGAGAF 205

  Fly   423 GGQVSCQSHSPSDSSIKSEPVSPSPSAIALNNNNNINNNHIMKREYSSAAAAAAAAAAAAAAGGG 487
            .|                                                ||||||||||||||.
Mouse   206 HG------------------------------------------------AAAAAAAAAAAAGGH 222

  Fly   488 ELNH 491
            ..:|
Mouse   223 THSH 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 62/70 (89%)
Sox21NP_808421.1 SOX-TCF_HMG-box 7..78 CDD:238684 62/70 (89%)
SOXp 77..>95 CDD:403523 12/18 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.