DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and Sox5

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:XP_006506994.1 Gene:Sox5 / 20678 MGIID:98367 Length:792 Species:Mus musculus


Alignment Length:443 Identity:105/443 - (23%)
Similarity:166/443 - (37%) Gaps:118/443 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KGSLLHATMPPH-HTSAALHGHAASPYSALAPLMNLGQSHLTHSQLSHHNHHHHHMSAHIAASQS 72
            :|:|..|..|.. ||..:.:.........:|..:||.....|....|..:....||.| :..:..
Mouse   391 QGNLGAAVSPTSIHTDKSTNSPPPKSKDEVAQPLNLSAKPKTSDGKSPASPTSPHMPA-LRINSG 454

  Fly    73 PNPL-SSLQSSMAN-TLNGSQVG------------QQQQQQQQQQSSPLHSSSELSPTQSSIGSH 123
            ..|| :|:.:::|: :...|.:|            |:.:|.::|......:........:|||..
Mouse   455 AGPLKASVPAALASPSARVSTIGYLNDHDAVTKAIQEARQMKEQLRREQQALDGKVAVVNSIGLS 519

  Fly   124 H------------MTSPVSHQQHTQQQ-QHGQQQHLGAGSALSSLTGGSSNNNNNSATANKNQQH 175
            :            :|..::.:|:.:.: .||......:|.:..|.....|.....|.....|:.|
Mouse   520 NCRTEKEKTTLESLTQQLAVKQNEEGKFSHGMMDFNMSGDSDGSAGVSESRIYRESRGRGSNEPH 584

  Fly   176 ADRVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHM 240
               :||||||||||::.:|||:....|.||||.|||.||::||.::..||:|:.:|..||...|:
Mouse   585 ---IKRPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKAMTNLEKQPYYEEQARLSKQHL 646

  Fly   241 KEHPDYKYRPRRKTKTLTKTKEKYPMGGLMPGQTVGGGAPGEPVTPTRVQGQPGQNQSLNGSGGS 305
            :::|||||:||.|...|...|:      |..|:                                
Mouse   647 EKYPDYKYKPRPKRTCLVDGKK------LRIGE-------------------------------- 673

  Fly   306 AAAAAAAAAAAAQQARQDMYQMNAPNGYMPNGYMMHADPAGAAAYQTSYMGQHYAAQRYDMGHMY 370
                   ..|..:..||:|.|      |...|.......|.|                   |.:|
Mouse   674 -------YKAIMRNRRQEMRQ------YFNVGQQAQIPIATA-------------------GVVY 706

  Fly   371 NNGYAMYQTVSGGQTSPYGSSLQQPGSPSPYGGSSLQQQPGSP---TPYGGGG 420
            .:..||     .|..||:        .||.:...|...:||.|   :.||..|
Mouse   707 PSAIAM-----AGMPSPH--------LPSEHSSVSSSPEPGMPVIQSTYGAKG 746

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 36/70 (51%)
Sox5XP_006506994.1 SOX-TCF_HMG-box 584..655 CDD:238684 37/73 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.