DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and Sox18

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_033262.2 Gene:Sox18 / 20672 MGIID:103559 Length:377 Species:Mus musculus


Alignment Length:292 Identity:88/292 - (30%)
Similarity:131/292 - (44%) Gaps:82/292 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 QQHAD--RVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRL 235
            :|.||  |::|||||||||::.:|:::|..||.:||:.:||.||..||:|:.:|||||::||:||
Mouse    71 RQTADELRIRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGKAWKELNTAEKRPFVEEAERL 135

  Fly   236 RAVHMKEHPDYKYRPRRKTKTLTKTKEKYPMGGLMPGQTVGGGAPGEPVTPTRVQGQPGQNQSLN 300
            |..|:::||:|||||||| |...|.:...| |.|:|| .|...||.|                  
Mouse   136 RVQHLRDHPNYKYRPRRK-KQARKVRRLEP-GLLLPG-LVQPSAPPE------------------ 179

  Fly   301 GSGGSAAAAAAAAAAAAQQARQ--------DMYQMNAPNGYMPNGYMMHADPAGAAAYQTSYMGQ 357
                    |.|||:.:|:..|:        |...:..|.....:|    .:|..|:.:......:
Mouse   180 --------AFAAASGSARSFRELPTLGAEFDGLGLPTPERSPLDG----LEPGEASFFPPPLAPE 232

  Fly   358 HYAAQRYDMGHMYNNGYAMYQTVSGGQTSPYGSSLQQPGSPSPYGGSSLQQ-----QPGSPTP-- 415
            ..|.:.:                    .:||...|.:  .||...|:.|.:     .|.:|..  
Mouse   233 DCALRAF--------------------RAPYAPELAR--DPSFCYGAPLAEALRTAPPAAPLAGL 275

  Fly   416 -YGGGGGGGGQVSCQSHSPSDSSIKSEPVSPS 446
             ||..|..|         |..:.:...|.|||
Mouse   276 YYGTLGTPG---------PFPNPLSPPPESPS 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 38/70 (54%)
Sox18NP_033262.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..76 2/4 (50%)
SOX-TCF_HMG-box 78..149 CDD:238684 38/70 (54%)
Interaction with DNA. /evidence=ECO:0000269|PubMed:26939885 81..94 9/12 (75%)
Interaction with DNA. /evidence=ECO:0000269|PubMed:26939885 105..117 6/11 (55%)
Important for transcriptional activation. /evidence=ECO:0000269|PubMed:10742113, ECO:0000269|PubMed:7651823 160..225 20/96 (21%)
Sox_C_TAD 187..375 CDD:288887 26/147 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.