DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and Sox13

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:XP_011246247.1 Gene:Sox13 / 20668 MGIID:98361 Length:621 Species:Mus musculus


Alignment Length:327 Identity:92/327 - (28%)
Similarity:135/327 - (41%) Gaps:85/327 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 PLSSLQSSMANTLNGSQVGQQQQQQQQQQSSPLHSSS-----ELSPTQSSIGSHHMTS----PVS 130
            ||..|.|..|..:..|.|......|:..|  ||:.::     || |..||..|..|.|    |.|
Mouse   263 PLQLLHSPPAPVVKRSGVAAHHPLQEPPQ--PLNLTAKPKVPEL-PNTSSSPSLKMNSCGPRPAS 324

  Fly   131 HQQHTQQQQHGQQQ----HLGAGSA-----------LSSLTGGSSNNNN----------NSATA- 169
            |...|:..|.....    .||.|.|           |.|.:|...|:.|          :|:.| 
Mouse   325 HGAPTRDLQSSPPSLPLGFLGEGDAVTKAIQDARQLLHSHSGALENSPNTPFRKDLISLDSSPAK 389

  Fly   170 ----------------------------NKNQQHADRVKRPMNAFMVWSRGQRRKMASDNPKMHN 206
                                        ::|..|   :||||||||||::.:|||:....|.|||
Mouse   390 ERLEESCVHPLEEAMLSCDMDGSRHFSESRNSSH---IKRPMNAFMVWAKDERRKILQAFPDMHN 451

  Fly   207 SEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMKEHPDYKYRPRRKTKTLTKTKEKYPMGGLMP 271
            |.|||.||::||.::..||:|:.:|..||...|::::|||||:||.|...:.:.:.      |..
Mouse   452 SSISKILGSRWKSMTNQEKQPYYEEQARLSRQHLEKYPDYKYKPRPKRTCVVEGRR------LRV 510

  Fly   272 GQTVGGGAPGEPVTPTRVQGQPGQNQSLNGSGGSAAAAA--AAAAAAAQQARQDMYQMNAPNGYM 334
            |:.       :.:..||.|| ..|:.::....|.|..::  ....||.....:.:.:...|.|..
Mouse   511 GEY-------KALMRTRRQG-ARQSYTIPPQAGQAQVSSDILFPRAAGLPLARPLVEHYDPQGLD 567

  Fly   335 PN 336
            ||
Mouse   568 PN 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 36/70 (51%)
Sox13XP_011246247.1 Atrophin-1 <231..>340 CDD:367360 24/79 (30%)
SOX-TCF_HMG-box 423..494 CDD:238684 37/73 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.