Sequence 1: | NP_001260269.1 | Gene: | SoxN / 44275 | FlyBaseID: | FBgn0029123 | Length: | 761 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_035568.1 | Gene: | Sox12 / 20667 | MGIID: | 98360 | Length: | 314 | Species: | Mus musculus |
Alignment Length: | 228 | Identity: | 81/228 - (35%) |
---|---|---|---|
Similarity: | 111/228 - (48%) | Gaps: | 64/228 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 179 VKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMKEH 243
Fly 244 PDYKYRPRRKTK-TLTKTKEKYPMGG-----LMPGQ-------------TVGGGAPG-------- 281
Fly 282 -EPVTPTRVQGQPGQN---------------QSLNGSGGSAAAAAAAA---------------AA 315
Fly 316 AAQQARQDMYQMNAPNGYMPNGYM--MHADPAG 346 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
SoxN | NP_001260269.1 | SOX-TCF_HMG-box | 178..249 | CDD:238684 | 43/69 (62%) |
Sox12 | NP_035568.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..40 | 81/228 (36%) | |
SOX-TCF_HMG-box | 39..110 | CDD:238684 | 43/69 (62%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 101..287 | 43/167 (26%) | |||
Required for transcriptional activation activity and synergistic coactivation of transcriptional activity with POU3F2. /evidence=ECO:0000269|PubMed:18403418 | 282..314 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0527 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S1275 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000028 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10270 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.860 |