DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and Sox12

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_035568.1 Gene:Sox12 / 20667 MGIID:98360 Length:314 Species:Mus musculus


Alignment Length:228 Identity:81/228 - (35%)
Similarity:111/228 - (48%) Gaps:64/228 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 VKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMKEH 243
            :|||||||||||:.:|||:....|.|||:|||||||.:|:.|.:|||.||:.||:|||..||.::
Mouse    40 IKRPMNAFMVWSQHERRKIMDQWPDMHNAEISKRLGRRWQLLQDSEKIPFVREAERLRLKHMADY 104

  Fly   244 PDYKYRPRRKTK-TLTKTKEKYPMGG-----LMPGQ-------------TVGGGAPG-------- 281
            ||||||||:|:| ...|.:.:.|.||     |.||.             .:||||..        
Mouse   105 PDYKYRPRKKSKGAPAKARPRPPGGGGGGSRLKPGPQLPGRGGRRASGGPLGGGAAAPEDDDEDE 169

  Fly   282 -EPVTPTRVQGQPGQN---------------QSLNGSGGSAAAAAAAA---------------AA 315
             |.:...|:...||:.               :...|..|..|||:||:               ||
Mouse   170 EEELLEVRLLETPGRELWRMVPAGRAARGPAERAQGPSGEGAAASAASPTLSEDEEPEEEEEEAA 234

  Fly   316 AAQQARQDMYQMNAPNGYMPNGYM--MHADPAG 346
            .|::..::    ...:|..|.|::  |...|||
Mouse   235 TAEEGEEE----TVVSGEEPLGFLSRMPPGPAG 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 43/69 (62%)
Sox12NP_035568.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 81/228 (36%)
SOX-TCF_HMG-box 39..110 CDD:238684 43/69 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..287 43/167 (26%)
Required for transcriptional activation activity and synergistic coactivation of transcriptional activity with POU3F2. /evidence=ECO:0000269|PubMed:18403418 282..314
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1275
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.