DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and sox-3

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_510439.1 Gene:sox-3 / 185534 WormBaseID:WBGene00004950 Length:212 Species:Caenorhabditis elegans


Alignment Length:171 Identity:90/171 - (52%)
Similarity:103/171 - (60%) Gaps:36/171 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 QQHADRVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRA 237
            |...|.||||||||||||||||||||.||||||||||||||||:||.|||.||||||||||||||
 Worm    42 QNSLDHVKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKQLSEQEKRPFIDEAKRLRA 106

  Fly   238 VHMKEHPDYKYRPRRKTKTLTKTKEKYPMGGLMPGQTVGGGAPGEPVTP---------------- 286
            :|||||||||||||||.|: :..|::..:...||           .:.|                
 Worm   107 LHMKEHPDYKYRPRRKPKS-SNLKQQPRLNIAMP-----------TIPPQSLFNYSTAFDSLKTH 159

  Fly   287 --TRVQGQPGQNQSLNGSG------GSAAAAAAAAAAAAQQ 319
              ::......|:..|:||.      .:|.|..|||.|||.|
 Worm   160 DLSQYYSSFFQSPVLSGSTYAPYNMMAAYARQAAAVAAASQ 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 64/70 (91%)
sox-3NP_510439.1 SOX-TCF_HMG-box 47..118 CDD:238684 64/70 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 139 1.000 Domainoid score I2973
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1275
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106862
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.