DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and sox-4

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_001335567.1 Gene:sox-4 / 182547 WormBaseID:WBGene00015716 Length:260 Species:Caenorhabditis elegans


Alignment Length:226 Identity:77/226 - (34%)
Similarity:108/226 - (47%) Gaps:48/226 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LTHSQLSHHN-HHHHHMSAHIAASQ-------SPN--PLSSLQSSMANTLNGSQVGQQQQQQQQQ 102
            |:|...|..| :.....:..|||:.       |||  ....|.:.||...:..||     .....
 Worm     2 LSHPYASAFNLYSQARKTTPIAAASSVSCPIVSPNMDATQKLLAIMATVKSFEQV-----NDSDG 61

  Fly   103 QSSPLHSSSELSPTQSSIGSHHMTSPVSHQQHTQQQQHGQQQHLGAGSALSSLTGGSSNNNNNSA 167
            .|||   ||..|||:|       .:.:|..|               .|.::.:.|...|.|:...
 Worm    62 LSSP---SSPESPTES-------PNVISSVQ---------------ASTIADIIGHYVNGNSIKD 101

  Fly   168 TANKNQQHAD--------RVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESE 224
            ..|.:|:.|.        |:|||||||||||:.:|:::|:...|.|||:|||.|||:|:.:.|.|
 Worm   102 VVNSSQKSASQPRTAREPRIKRPMNAFMVWSQQRRQQIAATGQKFHNSDISKMLGAEWRKMEEHE 166

  Fly   225 KRPFIDEAKRLRAVHMKEHPDYKYRPRRKTK 255
            |.||::.||:||..|...||||.|||||:.:
 Worm   167 KVPFVERAKQLREEHFNAHPDYVYRPRRRKR 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 39/70 (56%)
sox-4NP_001335567.1 SOX-TCF_HMG-box 120..191 CDD:238684 39/70 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.