DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and egl-13

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_001024918.1 Gene:egl-13 / 180833 WormBaseID:WBGene00001182 Length:470 Species:Caenorhabditis elegans


Alignment Length:297 Identity:85/297 - (28%)
Similarity:139/297 - (46%) Gaps:61/297 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LAPLMNLG----QSHLTHSQLSHHNHHHHHMSAHIAASQS------------------------- 72
            ::|:::.|    :..|...:|..|......::..:.|:||                         
 Worm   155 MSPMLHAGNFDSEMLLRQHELMQHQQQQMIIANMLKATQSLPLLFNGGLNYEAILNNPVLNATIA 219

  Fly    73 ---PNPLSSLQSSMANTLNGSQVGQQQQQQQQQQSSPLHSSSELSPTQSSIGSHHMTSPVS---- 130
               ||||:|..|.:..:::.........|..::..:||:.|.: :|:.::|..    ||:|    
 Worm   220 GHLPNPLASNISLLQKSISAKLAAAGNMQTVEKVETPLNLSKD-TPSPTAIPQ----SPLSGFRL 279

  Fly   131 -HQQHTQQQQHGQQQHLGAGSALSSLTGGSSNNNNNSATANKNQQHADRVKRPMNAFMVWSRGQR 194
             :...|.....||..:..:.::....|.|:::..:..||.....:..:.:||||||||||:|.:|
 Worm   280 PYSLGTNYGSDGQLFNNCSPNSSGKSTPGNTSVTSEVATPRPQAKSPNHIKRPMNAFMVWARDER 344

  Fly   195 RKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMKEHPDYKYRPRRKT----- 254
            ||:....|.||||.|||.||::||.:|.|||:|:.:|..||..:||::||||:||||.|.     
 Worm   345 RKILKAYPDMHNSNISKILGSRWKGMSNSEKQPYYEEQSRLSKLHMEQHPDYRYRPRPKRTCVID 409

  Fly   255 ---------KTLTKTKEKYPMGGLMPGQTVGGGAPGE 282
                     ||:.|||:     .||.|...|...|.:
 Worm   410 GKKVRVNEYKTIMKTKK-----DLMWGDEPGFSQPSD 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 40/70 (57%)
egl-13NP_001024918.1 SOX-TCF_HMG-box 328..399 CDD:238684 40/70 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.