DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and hmg-3

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_491688.1 Gene:hmg-3 / 172250 WormBaseID:WBGene00001973 Length:689 Species:Caenorhabditis elegans


Alignment Length:254 Identity:46/254 - (18%)
Similarity:90/254 - (35%) Gaps:72/254 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 SAHIAASQSPNPL------------SSL---------QSSMANTLNGSQVGQQQQQQQQQQSSPL 107
            |.|.|.|.|....            |||         .:.:.:.||..::..:...:...:|:..
 Worm   376 SCHFARSDSGTVTRTFDFEIDLKTGSSLTFSAMDKEENNKLFDYLNKKEIKIRNSHRIDNKSAGY 440

  Fly   108 HSSSE--LSPTQSSIGS-----------------HHMTSPVSHQQHTQQQQHGQ----QQHLGAG 149
            .||.|  :.|.:|::.:                 :.:...:..|::.:....|.    .....:|
 Worm   441 GSSDEDDIDPYKSTVKAEGREQDDDSDDESTDEDYDLDKDMKKQKNDKDSSEGSGSEPDDEYDSG 505

  Fly   150 SAL-SSLTGGSSNNNNN-------------------------SATANKNQQHADRVKRPMNAFMV 188
            |.. :|.||.|..:..|                         :....|..:..:..||...|:::
 Worm   506 SEKDASGTGESDPDEENIEPKKKESKEKKNKREKKEKPVKEKAVKKGKKTKDPNEPKRATTAYII 570

  Fly   189 WSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMKEHPDYK 247
            |....|..|..|...:  .:::|:.||:||.:|..:|:.:.|:|.:.:|.:..|..:||
 Worm   571 WFNANRNSMKEDGDTL--GDVAKKAGAKWKSMSADDKKEWNDKAAQDKARYEAEMKEYK 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 20/70 (29%)
hmg-3NP_491688.1 POB3 20..497 CDD:227494 18/120 (15%)
SSrecog 75..285 CDD:281523
PH2_SSRP1-like 332..429 CDD:270051 10/52 (19%)
HMGB-UBF_HMG-box 561..624 CDD:238686 18/64 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.